KEGG   Escherichia coli K-12 MG1655: b2310
Entry
b2310             CDS       T00007                                 

Gene name
argT
Definition
(RefSeq) lysine/arginine/ornithine ABC transporter periplasmic binding protein
  KO
K10013  lysine/arginine/ornithine transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b2310 (argT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2310 (argT)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    b2310 (argT)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 Lig_chan-Glu_bd LPAM_1
Other DBs
NCBI-GeneID: 949030
NCBI-ProteinID: NP_416813
Pasteur: argT
RegulonDB: ECK120000068
ECOCYC: EG10072
ASAP: ABE-0007621
UniProt: P09551
Position
complement(2427009..2427791)
AA seq 260 aa
MKKSILALSLLVGLSTAASSYAALPETVRIGTDTTYAPFSSKDAKGDFVGFDIDLGNEMC
KRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAK
GSPIQPTLDSLKGKHVGVLQGSTQEAYANETWRSKGVDVVAYANQDLVYSDLAAGRLDAA
LQDEVAASEGFLKQPAGKDFAFAGSSVKDKKYFGDGTGVGLRKDDAELTAAFNKALGELR
QDGTYDKMAKKYFDFNVYGD
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattctcgctctgtctttgttagtcggtctctccacagcggcttccagc
tatgcggcgctaccggagacggtacgtatcggaaccgataccacctacgcaccgttctca
tcgaaagatgctaaaggtgattttgttggctttgatatcgatctcggtaacgagatgtgc
aaacggatgcaggtgaaatgtacctgggttgccagtgactttgacgcgctgatcccctca
ctgaaagcgaaaaaaatcgacgctattatttcgtcgctttccattaccgataaacgtcag
caggagattgccttctccgacaagctgtacgccgcagattctcgtttgattgcggccaaa
ggttcaccgattcagccaacgctggattcactgaaaggtaaacatgttggtgtgctgcag
ggatcaacccaggaagcttacgctaacgagacctggcgtagtaaaggcgtggatgtggtg
gcctatgccaaccaggatttggtctattccgatctggctgcaggacgtctggatgctgcg
ttacaagatgaagttgctgccagcgaaggattcctcaagcaacctgctggtaaagatttc
gcctttgctggctcatcagtaaaagacaaaaaatacttcggtgatggcaccggtgtaggg
ctacgtaaagatgatgctgaactgacggctgccttcaataaggcgcttggcgagctgcgt
caggacggcacctacgacaagatggcgaaaaagtatttcgactttaatgtctacggtgac
tga

DBGET integrated database retrieval system