KEGG   Escherichia coli K-12 MG1655: b2411
Entry
b2411             CDS       T00007                                 

Gene name
ligA
Definition
(RefSeq) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03030  DNA replication
eco03410  Base excision repair
eco03420  Nucleotide excision repair
eco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    b2411 (ligA)
   03410 Base excision repair
    b2411 (ligA)
   03420 Nucleotide excision repair
    b2411 (ligA)
   03430 Mismatch repair
    b2411 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b2411 (ligA)
   03400 DNA repair and recombination proteins [BR:eco03400]
    b2411 (ligA)
Enzymes [BR:eco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     b2411 (ligA)
DNA replication proteins [BR:eco03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     b2411 (ligA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     b2411 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     b2411 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     b2411 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      b2411 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH RNA_ligase DZR_2 PUA_2 Zn-ribbon_8
Other DBs
NCBI-GeneID: 946885
NCBI-ProteinID: NP_416906
Pasteur: ligA
RegulonDB: ECK120000527
ECOCYC: EG10534
ASAP: ABE-0007938
UniProt: P15042
Structure
PDB: 
5TT5 4GLX 2OWO

Position
complement(2528161..2530176)
AA seq 671 aa
MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELETKHPELITPDSPTQ
RVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKNNEKVTWCCELKLDGLA
VSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGENIPARLEVRGEVFLPQAG
FEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGVLEGGELPDTHL
GRLLQFKKWGLPVSDRVTLCESAEEVLAFYHKVEEDRPTLGFDIDGVVIKVNSLAQQEQL
GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVHVAGVLVSNATLHN
ADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEDTREVVFPTHCPVCGSDVERVEG
EAVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAG
KLTGLERMGPKSAQNVVNALEKAKETTFARFLYALGIREVGEATAAGLAAYFGTLEALEA
ASIEELQKVPDVGIVVASHVHNFFAEESNRNVISELLAEGVHWPAPIVINAEEIDSPFAG
KTVVLTGSLSQMSRDDAKARLVELGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVI
DEAEMLRLLGS
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggaatcaatcgaacaacaactgacagaactgcgaacgacgcttcgccatcatgaatat
ctttatcatgtgatggatgcgccggaaattcccgacgctgaatacgacaggctgatgcgc
gaactgcgcgagctggaaaccaaacatccagaactgattacgcctgattcgcctactcaa
cgtgtaggcgctgcgccgctggcggctttcagccagatacgccatgaagtaccaatgctg
tcactggataacgtttttgatgaagaaagctttcttgctttcaacaaacgtgtgcaggac
cgtctgaaaaacaacgagaaagtcacctggtgctgtgagctgaagctggatggtcttgcc
gtcagtattctgtatgaaaatggcgttttagtcagtgccgcgacccgtggcgatggcacc
accggggaagatatcacgtctaatgtgcgtactattcgcgccattccgctgaagctgcac
ggagagaatatcccggcgcgtctggaagtgcgtggtgaagtgttcctgccgcaggcgggg
ttcgaaaagattaacgaagatgcgcgacgcacgggcgggaaagtgtttgctaacccacgt
aatgcggcagctggttcactgcgtcagcttgatccgcgtattacagcgaagcgaccgctc
acttttttctgctatggcgttggtgttctggaaggtggcgagctgccggatactcatctt
ggccgtttactgcaatttaaaaagtgggggttgccggtcagcgatcgggtaacgctttgt
gaatcggcggaagaagtgctggcgttctatcacaaagtggaagaagaccgcccgacgctg
ggctttgatatcgacggcgtggtgattaaggtcaactcactggcacagcaggagcagctt
ggctttgtcgcgcgtgccccgcgctgggcggtagcgtttaaattcccggcgcaggagcag
atgacctttgtgcgtgacgtcgagtttcaggttgggcgtactggcgcgattacgcctgtt
gcgcgtctggaacctgtccatgttgcaggcgtgctggtgagtaacgcaaccttacacaat
gcggatgaaatcgaacgtcttggtttacgcattggcgataaagtggtgattcgccgcgct
ggcgacgtgatcccgcaggtggttaacgtcgtgctttctgaacgcccggaagatacccgt
gaggttgtattcccgacgcattgtccggtatgtggttctgacgttgagcgtgtggaaggt
gaagcggttgcccgctgtaccggtggcctgatttgcggtgcgcagcgtaaagagtcgctg
aaacactttgtttcccgccgtgcgatggatgttgacggaatgggcgacaaaatcatcgat
cagctggttgaaaaagaatatgtccatactccggcagatctgttcaaactcaccgcaggc
aaactgaccggactggagcgtatggggccaaaatcggcacaaaacgtggttaacgcgctg
gaaaaagcgaaagaaaccacctttgctcgcttcctctatgcacttggcatccgtgaagtc
ggcgaggccaccgcagcaggtctggcggcatatttcggcacgctggaagcgctggaagcc
gcttcgattgaagagctgcaaaaggtgcctgatgttggcattgtcgttgcatcccacgtt
cacaacttctttgccgaagaaagcaaccgcaatgtcatcagcgagctgttggcggaaggt
gttcactggcctgcgccgatcgttatcaacgcggaagagattgacagcccgtttgctggt
aaaaccgtggtgcttacgggcagcttaagccagatgtcgcgtgatgacgctaaagctcga
ctggtcgaactgggcgcgaaagtcgcgggcagcgtgtcgaagaaaaccgatctggtgata
gcgggtgaagctgcaggatctaaactggcgaaggcgcaggaactgggcattgaagtcatc
gacgaagcggaaatgctgcgtttgctgggtagctga

DBGET integrated database retrieval system