KEGG   Escherichia coli K-12 MG1655: b2418Help
Entry
b2418             CDS       T00007                                 

Gene name
pdxK
Definition
(RefSeq) pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00750  Vitamin B6 metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    b2418 (pdxK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     b2418 (pdxK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phos_pyr_kin PfkB
Motif
Other DBs
NCBI-GeneID: 946881
NCBI-ProteinID: NP_416913
Pasteur: pdxK
RegulonDB: ECK120003833
ECOCYC: G7259
ASAP: ABE-0007973
UniProt: P40191
Structure
PDB: 

Position
complement(2536386..2537237)
Genome map
AA seq 283 aa AA seqDB search
MSSLLLFNDKSRALQADIVAVQSQVVYGSVGNSIAVPAIKQNGLNVFAVPTVLLSNTPHY
DTFYGGAIPDEWFSGYLRALQERDALRQLRAVTTGYMGTASQIKILAEWLTALRKDHPDL
LIMVDPVIGDIDSGIYVKPDLPEAYRQYLLPLAQGITPNIFELEILTGKNCRDLDSAIAA
AKSLLSDTLKWVVVTSASGNEENQEMQVVVVTADSVNVISHSRVKTDLKGTGDLFCAQLI
SGLLKGKALTDAVHRAGLRVLEVMRYTQQHESDELILPPLAEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttgttgttgtttaacgataagagtagggcactgcaggcggatatcgtcgcc
gtgcagtcgcaggtggtttacggcagcgtgggcaacagcattgccgtgcctgctatcaaa
cagaacggcctgaatgtctttgccgtgccgacggtattgctgagcaatacgccgcattat
gacactttctacggtggtgcgattccggacgaatggtttagcggctatttgcgtgcgctt
caggagcgtgatgcgctgcgccaacttcgtgctgtaaccacgggctatatgggaacggca
tcgcaaatcaaaatccttgccgagtggctgactgcgctacgcaaagaccatcctgaccta
ttgatcatggtcgatccggtgattggcgatattgatagcggaatttatgtcaaacctgac
cttcccgaagcgtatcgacaatatttactgccgctggcgcagggaattacccccaatatc
tttgagttggaaatcctgaccggtaaaaattgccgcgatctcgacagtgccattgctgcc
gcaaaaagtctgctttcagacacattaaaatgggtggtggttaccagcgcctccggtaat
gaagaaaatcaggagatgcaggttgtggtggtcactgccgacagcgtgaatgtcatttcc
cattcacgggtaaaaaccgacctgaaagggactggcgacctgttttgtgctcagctcatc
agtggcttgctgaaagggaaggcgttaaccgatgcagtgcaccgagcggggttgcgcgta
ctggaagtgatgcgctacacccagcagcatgagagcgatgaattgattttgccgccgctg
gcggaagcataa

DBGET integrated database retrieval system