KEGG   Escherichia coli K-12 MG1655: b2432
Entry
b2432             CDS       T00007                                 

Gene name
yfeY
Definition
(RefSeq) DUF1131 domain-containing lipoprotein YfeY
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF1131
Other DBs
NCBI-GeneID: 946919
NCBI-ProteinID: NP_416927
Pasteur: yfeY
RegulonDB: ECK120003841
ECOCYC: G7267
ASAP: ABE-0008017
UniProt: P76537
Structure
PDB: 
2QZB

Position
complement(2550641..2551216)
AA seq 191 aa
MKSLRLMLCAMPLMLTGCSTMSSVNWSAANPWNWFGSSTKVSEQGVGELTASTPLQEQAI
ADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGTISRIDVLDSDIPADTGV
KIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWRGPEGLMPSDDTLK
NWKVSKIIWRR
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaaatcgctgcgtttaatgttatgcgctatgccattgatgctgaccggctgttccacg
atgtcgtcagttaactggtctgccgctaacccgtggaactggtttgggtcgtccaccaaa
gtgagcgagcagggcgtgggtgaattaacggcgtccacaccactgcaagaacaagccatt
gccgatgcgcttgatggcgattatcgcctgcgcagcggaatgaaaaccgcgaacggcaac
gtggtgcgcttttttgaagtgatgaagggcgacaacgtggcgatggtgattaacggcgat
caaggcacgatcagtcgcattgacgtgctggatagcgatattcctgctgacaccggtgtt
aaaatcggtacaccgtttagcgacctttacagcaaagcatttggcaattgccaaaaagct
gatggtgatgataatcgtgccgtcgaatgtaaagccgaaggcagtcaacatattagctac
cagttcagcggggaatggcgtggtcctgaagggttaatgccttcggacgataccctgaaa
aactggaaagtcagtaaaattatctggcggcgttaa

DBGET integrated database retrieval system