KEGG   Escherichia coli K-12 MG1655: b2458Help
Entry
b2458             CDS       T00007                                 

Gene name
eutD
Definition
(RefSeq) phosphate acetyltransferase
  KO
K04020  phosphotransacetylase
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00620  Pyruvate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b2458 (eutD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-GeneID: 946940
NCBI-ProteinID: NP_416953
Pasteur: eutD
RegulonDB: ECK120003862
ECOCYC: G7288
ASAP: ABE-0008097
UniProt: P77218
Structure
PDB: 

Position
complement(2572489..2573505)
Genome map
AA seq 338 aa AA seqDB search
MIIERCRELALRAPARVVFPDALDQRVLKAAQYLHQQGLATPILVANPFELRQFALSHGV
AMDGLQVIDPHGNLAMREEFAHRWLARAGEKTPPDALEKLTDPLMFAAAMVSAGKADVCI
AGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQLAD
IALASAETWRAITGEEPRVAMLSFSSNGSARHPCVANVQQATEIVRERAPKLVVDGELQF
DAAFVPEVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQRLGGYRAVGPLIQGLAAPM
HDLSRGCSVQEIIELALVAAVPRQTEVNRESSLQTLVE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattattgaacgttgtcgtgaactggcgttgcgagcgcccgccagagtggtttttccg
gatgcgttagaccaacgtgtgctgaaagccgcgcaatatttacatcaacaaggtctggca
acgcccattctggtcgccaatccgtttgaacttcgtcagtttgcgctcagtcacggcgtg
gcgatggacgggctacaggtgattgatccgcatggcaacctcgcaatgcgggaagaattt
gctcatcgctggctggcccgcgcgggcgaaaaaacgccgccggatgcgctggaaaaactt
accgaccctctgatgttcgccgcagcaatggtcagcgccggtaaagcggatgtctgtatc
gcgggcaacctctcttccacggcaaatgtgctgcgtgccggattacgcattatcggcttg
cagccaggctgtaaaacgctctcttccattttcctgatgttgccacagtacagcggcccg
gcgttgggctttgccgattgcagcgtggtgccacagccgacggcggcgcagctggcggat
atcgcgcttgccagtgccgaaacctggcgcgccatcaccggagaagagccgcgcgtggcg
atgctgtcgttttccagcaatggtagcgcccgtcacccctgtgttgctaacgtccagcag
gcgacagaaatcgtccgtgagcgcgcaccaaagctggtggtggatggcgagttacagttt
gacgccgccttcgtgccggaagtggcggcgcaaaaagcgcctgccagcccgctacagggc
aaggccaatgtgatggtttttccgtcgctggaagccggaaatattggttacaaaatcgca
caacgactcggcggatatcgtgccgtcgggccactgatacaaggacttgccgcgccgatg
cacgatctctctcgtggttgtagcgtgcaggaaattatcgagctggcgctggtggcagct
gtgccgcgtcagacagaagtgaaccgcgaaagcagtttacaaacactggttgaatga

DBGET integrated database retrieval system