KEGG   Escherichia coli K-12 MG1655: b2468Help
Entry
b2468             CDS       T00007                                 

Gene name
aegA
Definition
(RefSeq) putative oxidoreductase, FeS binding subunit/NAD/FAD-binding subunit
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Fer4_9 Fer4_11 NAD_binding_8 Fer4_7 Pyr_redox_3 Fer4_6 Fer4 FAD_binding_3 Fer4_10 DAO HI0933_like Fer4_2 Thi4 NAD_binding_7 AlaDh_PNT_C Fer4_21 FAD_oxidored Fer4_4 FAD_binding_2 2-Hacid_dh_C Amino_oxidase Shikimate_DH FMO-like NAD_binding_9 XdhC_C 3HCDH_N NAD_Gly3P_dh_N Lycopene_cycl GIDA IlvN ETF_QO Fer4_8
Motif
Other DBs
NCBI-GeneID: 947383
NCBI-ProteinID: NP_416963
Pasteur: aegA
RegulonDB: ECK120002270
ECOCYC: EG12409
ASAP: ABE-0008127
UniProt: P37127
Position
complement(2583546..2585525)
Genome map
AA seq 659 aa AA seqDB search
MNRFIMANSQQCLGCHACEIACVMAHNDEQHVLSQHHFHPRITVIKHQQQRSAVTCHHCE
DAPCARSCPNGAISHVDDSIQVNQQKCIGCKSCVVACPFGTMQIVLTPVAAGKVKATAHK
CDLCAGRENGPACVENCPADALQLVTDVALSGMAKSRRLRTARQEHQPWHASTAAQEMPV
MSKVEQMQATPARGEPDKLAIEARKTGFDEIYLPFRADQAQREASRCLKCGEHSVCEWTC
PLHNHIPQWIELVKAGNIDAAVELSHQTNTLPEITGRVCPQDRLCEGACTIRDEHGAVTI
GNIERYISDQALAKGWRPDLSHVTKVDKRVAIIGAGPAGLACADVLTRNGVGVTVYDRHP
EIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVSLDSLLEQYDAVFVGV
GTYRSMKAGLPNEDAPGVYDALPFLIANTKQVMGLEELPEEPFINTAGLNVVVLGGGDTA
MDCVRTALRHGASNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQGHV
CGIRFLRTRLGEPDAQGRRRPVPVEGSEFVMPADAVIMAFGFNPHGMPWLESHGVTVDKW
GRIIADVESQYRYQTTNPKIFAGGDAVRGADLVVTAMAEGRHAAQGIIDWLGVKSVKSH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttttattatggccaacagtcagcaatgtctgggttgtcatgcttgtgaaatc
gcctgtgtcatggctcacaatgatgagcaacatgtcctgagccaacaccattttcatccc
cgaattacggttatcaaacatcaacagcaacgtagtgcagtgacctgtcaccattgtgaa
gatgcgccctgcgcccgtagctgccctaatggcgcaatcagccacgttgatgacagcatt
caggtcaatcagcaaaagtgtattggctgtaaatcctgcgtggtggcctgtccttttggt
acgatgcaaatcgtcctgacacccgtcgcggcaggaaaagtaaaagccacggcgcataaa
tgcgacctttgtgcggggcgcgaaaacggtcctgcctgtgttgagaattgcccggcggac
gcgctgcaactggtcactgacgtcgcactctccggcatggcgaaatcccgccgcttgcgc
accgcgcgtcaggaacatcaaccgtggcatgccagtaccgcggcgcaagaaatgccggta
atgagtaaagtcgaacaaatgcaggcaacgcccgcgcgtggcgagccggataaactggcg
attgaagcgcgcaaaaccggttttgatgaaatttatctgccatttcgcgccgaccaggca
caacgggaagcctcgcgctgccttaagtgcggcgagcacagcgtttgtgaatggacctgc
ccgctgcataaccatataccgcagtggattgaactggtgaaagccggaaacatcgacgcc
gccgtcgagctttctcaccagaccaacaccctgccggaaattaccggacgcgtttgtccg
caagaccgtttgtgtgaaggtgcctgtactattcgcgatgagcacggcgcggtaactatc
ggcaacattgaacgctacatttcagatcaggcgttggcgaaaggttggcgtcctgactta
agccatgtcaccaaagtggacaagcgggtggcgattatcggtgcaggtccggcagggctg
gcctgtgcggatgttctgacccgcaatggcgtgggggtgacggtgtacgatcgccatcca
gaaatcggtggcttgctcactttcggcattccttctttcaaactggataaatccctgctg
gcacgccgtcgggaaatcttcagcgcgatggggattcacttcgaactcaattgtgaagtg
ggtaaagatgtctctttggattcgcttttggaacaatacgacgcggtcttcgttggcgta
ggcacttaccgttccatgaaagcgggtttacccaatgaagatgcgccgggcgtttatgac
gcgctgccgttcctcattgccaacactaaacaggtgatggggctcgaagagctaccggaa
gagccgtttatcaataccgccggacttaacgtcgtggtactgggcggcggcgacaccgcg
atggactgtgtgcgtaccgcactgcgccacggcgcgagtaacgtcacctgcgcttatcgt
cgtgatgaagctaacatgccaggctcgaagaaagaagtgaagaacgcccgcgaagagggg
gccaacttcgaatttaacgtccagccggtggcgcttgagctgaatgaacaaggtcacgtc
tgcgggattcgtttcctgcgcacgcgtcttggagagccggatgcccaggggcgtcggcgt
ccagtgccggtggaaggcagtgaatttgtcatgccagccgacgcggtgattatggcgttt
ggcttcaatccgcacgggatgccgtggctggagtcgcacggtgtaacggtagacaaatgg
ggccgcatcatcgcggatgtggaaagccagtaccgttaccagaccaccaatccgaaaatc
ttcgctggtggtgacgccgtgcgtggtgcggatctggtggttaccgcaatggcagaagga
cgtcatgcggcacaggggattattgactggctgggggtaaaatcagtcaaatctcactga

DBGET integrated database retrieval system