KEGG   Escherichia coli K-12 MG1655: b2490Help
Entry
b2490             CDS       T00007                                 

Gene name
hyfJ
Definition
(RefSeq) putative hydrogenase 4 assembly protein
  KO
K12145  hydrogenase-4 component J [EC:1.-.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b2490 (hyfJ)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     b2490 (hyfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HycH
Motif
Other DBs
NCBI-GeneID: 947713
NCBI-ProteinID: NP_416985
Pasteur: hyfJ
RegulonDB: ECK120003879
ECOCYC: G7307
ASAP: ABE-0008200
UniProt: P77453
Position
2611457..2611870
Genome map
AA seq 137 aa AA seqDB search
MTEECGEIVFWTLRKKFVASSDEMPEHSSQVMYYSLAIGHHVGVIDCLNVAFRCPLTEYE
DWLALVEEEQARRKMLGVMTFGEIVIDASHTALLTRAFAPLADDATSVWQARSIQFIHLL
DEIVQEPAIYLMARKIA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagagtgcggggaaattgttttctggacgctgcgaaaaaagtttgtcgccagt
agcgacgagatgccggaacacagctctcaggtaatgtattactcgctagctatcggccat
cacgttggcgtgattgattgtctgaatgtcgccttccgctgcccactgacggaatacgaa
gattggcttgcactggtcgaagaggagcaagcccgacgtaagatgctgggggtgatgact
tttggtgagattgttattgacgccagccacaccgccctgttgacccgggcattcgcgcca
ctggcggatgacgcgacgtctgtgtggcaggcgcgtagcattcaattcattcatctgttg
gatgaaattgtgcaggaaccggccatctatctgatggccagaaaaattgcgtga

DBGET integrated database retrieval system