KEGG   Escherichia coli K-12 MG1655: b2492Help
Entry
b2492             CDS       T00007                                 

Gene name
focB
Definition
(RefSeq) putative formate transporter
  KO
K03459  formate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2492 (focB)
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b2492 (focB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Form_Nir_trans
Motif
Other DBs
NCBI-GeneID: 949032
NCBI-ProteinID: NP_416987
Pasteur: focB
RegulonDB: ECK120003881
ECOCYC: G7309
ASAP: ABE-0008206
UniProt: P77733 A0A387CYS5
Position
2613934..2614782
Genome map
AA seq 282 aa AA seqDB search
MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAP
SSQALTHLVGGLCFTLGFILLAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGN
LAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTFTESVSLGIMCNLMVCLALWM
SYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPPPFWQLAHSSADN
FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQEP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaactctctttcgacttgcagttgagcgccagaaaagcggcaatcgctgaa
cggattgccgcccataaaattgcccgcagtaaagtgtcggtctttttaatggcgatgtcc
gctggcgtgtttatggcgatcggatttactttttacctttccgttatcgccgatgccccg
tcttcacaggcattaacccatctggtgggcggcctttgctttacactcggctttattttg
ctggcggtttgcggcaccagcctgttcacctcgtcggtaatgacggtgatggcaaaaagt
cggggcgttattagttggcgaacttggctgattaacgcacttctggtggcctgcggtaat
ctggcaggtattgcctgtttcagtttgttaatctggttttccgggctggtgatgagtgaa
aacgcgatgtggggagtcgcggttttacactgcgccgagggcaaaatgcatcatacattt
actgaatctgtcagcctcggcattatgtgcaatctgatggtttgcctggcgctgtggatg
agttattgcgggcgttcgttatgcgacaaaatcgtcgccatgattttgcccatcaccctg
tttgtcgccagtggctttgagcactgtatcgccaatttgtttgtgattccgttcgccatt
gccattcgccatttcgcccctccccccttctggcagctggcgcacagtagcgcagacaat
tttccggcactgacggtcagccattttattaccgccaatctgctcccggtgatgctgggt
aatattatcggcggtgcggtgctggtgagtatgtgttatcgggctatttatttacgtcag
gaaccctga

DBGET integrated database retrieval system