KEGG   Escherichia coli K-12 MG1655: b2496Help
Entry
b2496             CDS       T00007                                 

Gene name
hda
Definition
(RefSeq) inibitor of reinitiation of DNA replication
  KO
K10763  DnaA-homolog protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b2496 (hda)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    b2496 (hda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA AAA_16
Motif
Other DBs
NCBI-GeneID: 946977
NCBI-ProteinID: NP_416991
RegulonDB: ECK120003885
ECOCYC: G7313
ASAP: ABE-0008217
UniProt: P69931
Structure
PDB: 

Position
complement(2618075..2618776)
Genome map
AA seq 233 aa AA seqDB search
MNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLL
HAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDL
YNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARL
RGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIPFVKEILKL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ctgaacacaccggcacagctctctttgccactttatcttcctgacgacgaaacctttgca
agtttctggccgggggataactcctctttactggccgcgctgcaaaacgtgctgcgtcag
gaacatagcggttacatctatctctgggcacgcgaaggcgcggggcgcagccatctgctg
cacgcggcttgcgcggaattgtcgcagcgtggcgatgcggtgggctatgtcccgctggat
aaacgcacctggtttgttccggaagtgctcgacggtatggagcatttgtcgctggtctgt
atcgacaacattgagtgtattgcaggcgatgagttgtgggagatggcgattttcgatctc
tacaatcgaattctggaatcgggcaaaacacggttgttgatcaccggcgatcgtccaccg
cggcagttgaatctgggattaccggatctcgcgtcgcgactcgactgggggcagatctac
aaattgcagccactttctgatgaagataagttgcaggcgctacagttacgcgcgcgtttg
cgtggttttgaactgccggaagatgtggggcgtttcttgctgaagcggctcgacagagaa
atgcgcacgctatttatgacgttggatcagttggatcgtgcgtcgattaccgcgcaacgt
aagctgaccattccgtttgtgaaagaaattctgaagttgtag

DBGET integrated database retrieval system