KEGG   Escherichia coli K-12 MG1655: b2498
Entry
b2498             CDS       T00007                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2498 (upp)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     b2498 (upp)
SSDB
Motif
Pfam: UPRTase Pribosyltran Pribosyl_synth DUF3263
Other DBs
NCBI-GeneID: 946979
NCBI-ProteinID: NP_416993
Pasteur: upp
RegulonDB: ECK120001303
ECOCYC: EG11332
ASAP: ABE-0008224
UniProt: P0A8F0
Structure
PDB: 
2EHJ

Position
complement(2620246..2620872)
AA seq 208 aa
MKIVEVKHPLVKHKLGLMREQDISTKRFRELASEVGSLLTYEATADLETEKVTIEGWNGP
VEIDQIKGKKITVVPILRAGLGMMDGVLENVPSARISVVGMYRNEETLEPVPYFQKLVSN
IDERMALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAAPEGIAALEKAHPDVELYT
ASIDQGLNEHGYIIPGLGDAGDKIFGTK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagatcgtggaagtcaaacacccactcgtcaaacacaagctgggactgatgcgtgag
caagatatcagcaccaagcgctttcgcgaactcgcttccgaagtgggtagcctgctgact
tacgaagcgaccgccgacctcgaaacggaaaaagtaactatcgaaggctggaacggcccg
gtagaaatcgaccagatcaaaggtaagaaaattaccgttgtgccaattctgcgtgcgggt
cttggtatgatggacggtgtgctggaaaacgttccgagcgcgcgcatcagcgttgtcggt
atgtaccgtaatgaagaaacgctggagccggtaccgtacttccagaaactggtttctaac
atcgatgagcgtatggcgctgatcgttgacccaatgctggcaaccggtggttccgttatc
gcgaccatcgacctgctgaaaaaagcgggctgcagcagcatcaaagttctggtgctggta
gctgcgccagaaggtatcgctgcgctggaaaaagcgcacccggacgtcgaactgtatacc
gcatcgattgatcagggactgaacgagcacggatacattattccgggcctcggcgatgcc
ggtgacaaaatctttggtacgaaataa

DBGET integrated database retrieval system