KEGG   Escherichia coli K-12 MG1655: b2521
Entry
b2521             CDS       T00007                                 

Gene name
sseA
Definition
(RefSeq) 3-mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00270  Cysteine and methionine metabolism
eco00920  Sulfur metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    b2521 (sseA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    b2521 (sseA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    b2521 (sseA)
Enzymes [BR:eco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     b2521 (sseA)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     b2521 (sseA)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 946993
NCBI-ProteinID: NP_417016
Pasteur: sseA
RegulonDB: ECK120001548
ECOCYC: EG11600
ASAP: ABE-0008299
UniProt: P31142
Structure
PDB: 
1URH

Position
2652494..2653339
AA seq 281 aa
MSTTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSD
HTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILG
GGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVVKVTDVLLASHENTAQIIDARPAARF
NAEVDEPRPGLRRGHIPGALNVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVSCGS
GVTAAVVLLALATLDVPNVKLYDGAWSEWGARADLPVEPVK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtccacgacatggtttgtaggagccgactggctcgccgaacatattgatgacccggaa
attcagattatcgatgcccgcatggcgtcgcctggacaggaggatcgtaacgttgctcag
gagtatctgaatggacatattcccggcgcagtgttttttgatatcgaagcgctttctgat
cacacttccccgcttccgcacatgctgccgcgcccggaaacgttcgccgtggcgatgcgt
gaattaggcgttaaccaggataagcacctgattgtctatgacgaaggtaatcttttctca
gccccacgagcatggtggatgctgcgcacctttggtgtagagaaagtgtcgattctgggg
ggtggacttgcaggctggcagcgcgatgatctgctgttagaagaaggtgcagtagagctg
ccggaaggagagtttaacgccgcgtttaatcctgaagccgtggtgaaagtaaccgatgta
ttattggcaagccatgaaaatacggcgcaaattattgatgcccgcccggctgcacgtttt
aacgcagaagttgatgaacctcgcccaggtttacgtcgcggacatattcccggagcactg
aatgttccgtggacggaactggtgcgcgaaggcgaactaaaaacgaccgatgaactggat
gcgatattttttggtcgcggcgtcagctacgacaaaccaattatcgtcagctgcggctct
ggtgtaacggcagccgtggttttgttagcactcgcgacgctggatgtgccaaacgtgaaa
ctgtacgacggcgcatggagtgaatggggcgcgcgggcagatttaccggttgagccagtg
aaataa

DBGET integrated database retrieval system