KEGG   Escherichia coli K-12 MG1655: b2546
Entry
b2546             CDS       T00007                                 

Gene name
yphD
Definition
(RefSeq) putative ABC transporter membrane subunit YphD
  KO
K23546  sugar transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b2546 (yphD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2546 (yphD)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Sugar transporter
    b2546 (yphD)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-GeneID: 949063
NCBI-ProteinID: NP_417041
Pasteur: yphD
RegulonDB: ECK120003910
ECOCYC: G7340
ASAP: ABE-0008373
UniProt: P77315
Position
complement(2675827..2676825)
AA seq 332 aa
MSASSLPLPQGKSVSLKQFVSRHINEIGLLVVIAILYLVFSLNAPGFISLNNQMNVLRDA
ATIGIAAWAMTLIIISGEIDVSVGPMVAFVSVCLAFLLQFEVPLAVACLLVLLLGALMGT
LAGVLRGVFNVPSFVATLGLWSALRGMGLFMTNALPVPIDENEVLDWLGGQFLGVPVSAL
IMIVLFALFVFISRKTAFGRSVFAVGGNATAAQLCGINVRRVRILIFTLSGLLAAVTGIL
LAARLGSGNAGAANGLEFDVIAAVVVGGTALSGGRGSLFGTLLGVLVITLIGNGLVLLGI
NSFFQQVVRGVIIVVAVLANILLTQRSSKAKR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtctgcttcgtcattaccattgccgcagggcaagagcgtctcgctcaaacaatttgtc
agtcgccatattaatgagatcggtttgctggtggtgattgccattctttatctggtcttc
tccctgaacgcgcctggctttatctcattgaataaccagatgaacgtgctgcgcgatgcc
gccaccattgggattgccgcctgggcgatgacgctgattattatctccggtgaaattgat
gtcagcgttgggccgatggtggcttttgtctcggtgtgcctggcatttttgctgcaattt
gaagttccgctggcggtggcgtgcctgctggtgttgctgttaggcgcgctgatgggaacg
ctggccggggtgctgcgcggcgtgtttaatgtaccaagtttcgttgccacactggggctg
tggagcgccctgcgcggaatggggctgtttatgacgaacgcactgccagtgccgattgat
gaaaacgaggtgctggactggctgggcggacaatttctcggtgtgccggtatccgcgctg
atcatgattgtgttgtttgcgctgtttgtgttcatcagccgcaaaaccgccttcgggcgc
tcggtttttgccgttggcggtaatgctacggcggcgcagttgtgcggcatcaacgttcgt
cgggtgcgcattcttatctttaccctttcgggattattagcggcggtgaccggcattttg
ttggcggcgcgcctcggttctggtaacgcaggtgccgcaaacggtctggagtttgacgtc
atcgccgcggtcgtggtcggcggtacggcactttccggcggtcgcggttccctgttcggt
acattgcttggtgtgctggtgattacgctaatcggtaacggtctggtgctgctcggtatt
aactcctttttccagcaggtggtacgcggcgtcatcatcgtggtggcggtgctggcgaat
atcttgctgacccagcgaagcagtaaagcgaaacgctaa

DBGET integrated database retrieval system