KEGG   Escherichia coli K-12 MG1655: b2561Help
Entry
b2561             CDS       T00007                                 

Gene name
yfhH
Definition
(RefSeq) putative DNA-binding transcriptional regulator YfhH
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 SIS_2 HTH_Crp_2 Ifi-6-16 MarR
Motif
Other DBs
NCBI-GeneID: 947030
NCBI-ProteinID: NP_417056
Pasteur: yfhH
RegulonDB: ECK120002185
ECOCYC: EG12308
ASAP: ABE-0008428
UniProt: P37767
Position
2698759..2699607
Genome map
AA seq 282 aa AA seqDB search
MNGLLRIRQRYQGLAQSDKKLADYLLLQPDTARHLSSQQLANEAGVSQSSVVKFAQKLGY
KGFPALKLALSEALASQPESPSVPIHNQIRGDDPLRLVGEKLIKENTAAMYATLNVNSEE
KLHECVTMLRSARRIILTGIGASGLVAQNFAWKLMKIGFNAAAVRDMHALLATVQASSPD
DLLLAISYTGVRRELNLAADEMLRVGGKVLAITGFTPNALQQRASHCLYTIAEEQATNSA
SISACHAQGMLTDLLFIALIQQDLELAPERIRHSEALVKKLV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcttacttcgtatccgtcagcgttaccaggggcttgcccagagtgataaaaaa
ctggcggattatctgctgctacaacctgatacggcgcgccatttaagctctcagcaactg
gccaacgaagccggagtcagtcagtccagcgtcgtgaagttcgcgcaaaaactcggctat
aaaggttttccggcgcttaagttggcgttgagtgaagcgctggcaagccagccggaatca
ccctccgtgcccattcataaccaaatccgcggtgatgatccgttacggctggtcggcgaa
aaactgattaaagaaaatactgccgctatgtacgcaacgctaaacgttaatagtgaagag
aaactgcatgaatgcgtaacaatgttgcgctctgcgcggcggataattctgaccggtatt
ggcgcttcgggtctggtggcgcaaaactttgcctggaagctgatgaagattggcttcaat
gctgccgcagtgcgcgatatgcatgcgctactcgcaacagtacaggcgtcgtcccctgac
gatctgttattagccatttcctacaccggtgtacgacgcgagttaaacctggcggcagat
gagatgctgcgagtgggcggaaaagtgctggcgattaccggctttactccgaatgccctg
caacagcgtgcttctcattgcctgtataccattgccgaagaacaagcgacaaacagtgct
tcaatctctgcttgtcacgctcagggaatgttaacggatttgctgttcattgcgctgatt
cagcaggatctggaactggcaccagaacgtattcgtcatagtgaagcgctggtgaaaaaa
ctggtctga

DBGET integrated database retrieval system