KEGG   Escherichia coli K-12 MG1655: b2615
Entry
b2615             CDS       T00007                                 

Gene name
nadK
Definition
(RefSeq) NAD kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00760  Nicotinate and nicotinamide metabolism
eco01100  Metabolic pathways
eco01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b2615 (nadK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     b2615 (nadK)
SSDB
Motif
Pfam: NAD_kinase
Other DBs
NCBI-GeneID: 947092
NCBI-ProteinID: NP_417105
Pasteur: yfjB
RegulonDB: ECK120002081
ECOCYC: EG12192
ASAP: ABE-0008603
UniProt: P0A7B3
Position
2750831..2751709
AA seq 292 aa
MNNHFKCIGIVGHPRHPTALTTHEMLYRWLCTKGYEVIVEQQIAHELQLKNVKTGTLAEI
GQLADLAVVVGGDGNMLGAARTLARYDIKVIGINRGNLGFLTDLDPDNAQQQLADVLEGH
YISEKRFLLEAQVCQQDCQKRISTAINEVVLHPGKVAHMIEFEVYIDEIFAFSQRSDGLI
ISTPTGSTAYSLSAGGPILTPSLDAITLVPMFPHTLSARPLVINSSSTIRLRFSHRRNDL
EISCDSQIALPIQEGEDVLIRRCDYHLNLIHPKDYSYFNTLSTKLGWSKKLF
NT seq 879 nt   +upstreamnt  +downstreamnt
atgaataatcatttcaagtgtattggcattgtgggacacccacggcaccccactgcactg
acaacacatgaaatgctctaccgctggctgtgcacaaaaggttacgaggtcatcgttgag
caacaaatcgctcacgaactgcaactgaagaatgtgaaaactggcacgctcgcggagatt
gggcaactagctgatctcgcggtagtcgttggtggcgacggtaatatgctgggcgcggca
cgcacactcgcccgttacgatattaaagttattggaatcaaccgtggcaacctgggtttc
ctgactgaccttgaccccgataacgcccagcaacagttagccgatgtgctggaaggccac
tacatcagcgagaaacgttttttgctggaagcgcaagtctgtcagcaagattgccagaaa
cgcatcagcaccgcgataaatgaagtggtgcttcatccaggcaaagtggcgcatatgatt
gagttcgaagtgtatatcgacgagatctttgcgttttctcagcgatctgatggactaatt
atttcgacgccaacaggctccaccgcctattccctctctgcaggcggtcctattctgacc
ccctctctggatgcgattaccctggtgcccatgttcccgcatacgttgtcagcacgacca
ctggtcataaacagcagcagcacgatccgtctgcgtttttcgcatcgccgtaacgacctg
gaaatcagttgcgacagccagatagcactgccgattcaggaaggtgaagatgtcctgatt
cgtcgctgtgattaccatctgaatctgattcatccgaaagattacagttatttcaacaca
ttaagcaccaagctcggctggtcaaaaaaattattctaa

DBGET integrated database retrieval system