KEGG   Escherichia coli K-12 MG1655: b2685Help
Entry
b2685             CDS       T00007                                 

Gene name
emrA
Definition
(RefSeq) multidrug efflux pump membrane fusion protein EmrA
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00701  Multidrug resistance, efflux pump EmrAB
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2685 (emrA)
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b2685 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl Orf78
Motif
Other DBs
NCBI-GeneID: 947166
NCBI-ProteinID: NP_417170
Pasteur: emrA
RegulonDB: ECK120001323
ECOCYC: EG11354
ASAP: ABE-0008838
UniProt: P27303 A0A387CYL1
Position
2811427..2812599
Genome map
AA seq 390 aa AA seqDB search
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaatgcggagactcaaaccccgcagcaaccggtaaagaagagcggcaaacgt
aagcgtctgctcctccttctcaccttgctctttataattattgccgtagcgatagggatt
tattggtttttggtactgcgtcacttcgaagaaaccgatgacgcatacgtggcagggaat
caaattcaaattatgtctcaggtgtctggcagcgtgacgaaagtctgggccgataacacc
gattttgtaaaagaaggcgacgtgctggtcactctcgacccgacagatgctcgccaggcg
tttgaaaaagccaaaactgcactggcttccagcgttcgccaaacccaccagctgatgatt
aacagcaagcagttgcaggcgaatattgaggtgcagaaaatcgccctcgcgaaagcacaa
agcgactacaaccgccgtgtgccgctgggcaatgccaacctgattggtcgcgaagagctg
caacacgcccgcgacgccgtcaccagtgcccaggcgcaactggacgtcgcgattcaacaa
tacaatgccaatcaggcgatgattctggggactaaactggaagatcagccagccgtgcaa
caggctgccaccgaagtacgtaacgcctggctggcgctggagcgtactcgtattatcagt
ccgatgaccggttatgtctcccgccgcgcggtacagcctggggcgcaaattagcccaacg
acgccgctgatggcggtcgttccagccaccaatatgtgggtggatgccaactttaaagag
acgcagattgccaatatgcgtatcggtcagccggtcactatcaccacggatatttacggc
gatgatgtgaaatacaccggtaaagtggttggtctggatatgggcacaggtagcgcgttc
tcactgcttccagcgcaaaatgcgaccggtaactggatcaaagtcgttcagcgtctgcct
gtgcgtatcgaactggaccagaaacagctggagcaatatccgctgcgtatcggtttgtcc
acgctggtgagcgtcaataccactaaccgtgacggtcaggtactggcaaataaagtacgt
tccactccggtagcggtaagcaccgcgcgtgaaatcagcctggcacctgtcaataaactg
atcgacgatatcgtaaaagctaacgctggctaa

DBGET integrated database retrieval system