KEGG   Escherichia coli K-12 MG1655: b2699Help
Entry
b2699             CDS       T00007                                 

Gene name
recA
Definition
(RefSeq) DNA recombination and repair protein; ssDNA-dependent ATPase; synaptase; ssDNA and dsDNA binding protein; ATP-dependent homologous DNA strand exchanger; recombinase A; LexA autocleavage cofactor
  KO
K03553  recombination protein RecA
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    b2699 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eco03400]
    b2699 (recA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     b2699 (recA)
    RecFOR pathway proteins
     b2699 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    b2699 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase AAA_24 ATPase_2 AAA_16 AAA_25 CbiA AAA_35 PAXNEB Ribosomal_S24e MobB AAA_22 AAA CobU AAA_14 TK DnaB_C
Motif
Other DBs
NCBI-GeneID: 947170
NCBI-ProteinID: NP_417179
Pasteur: recA
RegulonDB: ECK120000814
ECOCYC: EG10823
ASAP: ABE-0008876
UniProt: P0A7G6
Structure
PDB: 

Position
complement(2822708..2823769)
Genome map
AA seq 353 aa AA seqDB search
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG
SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIG
QGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacgaaaacaaacagaaagcgttggcggcagcactgggccagattgagaaa
caatttggtaaaggctccatcatgcgcctgggtgaagaccgttccatggatgtggaaacc
atctctaccggttcgctttcactggatatcgcgcttggggcaggtggtctgccgatgggc
cgtatcgtcgaaatctacggaccggaatcttccggtaaaaccacgctgacgctgcaggtg
atcgccgcagcgcagcgtgaaggtaaaacctgtgcgtttatcgatgctgaacacgcgctg
gacccaatctacgcacgtaaactgggcgtcgatatcgacaacctgctgtgctcccagccg
gacaccggcgagcaggcactggaaatctgtgacgccctggcgcgttctggcgcagtagac
gttatcgtcgttgactccgtggcggcactgacgccgaaagcggaaatcgaaggcgaaatc
ggcgactctcacatgggccttgcggcacgtatgatgagccaggcgatgcgtaagctggcg
ggtaacctgaagcagtccaacacgctgctgatcttcatcaaccagatccgtatgaaaatt
ggtgtgatgttcggtaacccggaaaccactaccggtggtaacgcgctgaaattctacgcc
tctgttcgtctcgacatccgtcgtatcggcgcggtgaaagagggcgaaaacgtggtgggt
agcgaaacccgcgtgaaagtggtgaagaacaaaatcgctgcgccgtttaaacaggctgaa
ttccagatcctctacggcgaaggtatcaacttctacggcgaactggttgacctgggcgta
aaagagaagctgatcgagaaagcaggcgcgtggtacagctacaaaggtgagaagatcggt
cagggtaaagcgaatgcgactgcctggctgaaagataacccggaaaccgcgaaagagatc
gagaagaaagtacgtgagttgctgctgagcaacccgaactcaacgccggatttctctgta
gatgatagcgaaggcgtagcagaaactaacgaagatttttaa

DBGET integrated database retrieval system