KEGG   Escherichia coli K-12 MG1655: b2713Help
Entry
b2713             CDS       T00007                                 

Gene name
hydN
Definition
(RefSeq) formate dehydrogenase-H, [4Fe-4S] ferredoxin subunit
  KO
K05796  electron transport protein HydN
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4 Fer4_9 Fer4_7 Fer4_2 Fer4_11 Fer4_10 Fer4_16 Fer4_3 Fer4_21 Fer4_4 Fer4_8 Fer4_17 Fer4_20
Motif
Other DBs
NCBI-GeneID: 947190
NCBI-ProteinID: NP_417193
Pasteur: hydN
RegulonDB: ECK120001505
ECOCYC: EG11552
ASAP: ABE-0008919
UniProt: P0AAK4
Position
complement(2837578..2838105)
Genome map
AA seq 175 aa AA seqDB search
MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATVCRQ
CEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVIRNSGAGLN
VRADKAEANKCDLCNHREDGPACMAACPTHALICVDRNKLEQLSAEKRRRTALMF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttcatcattgctgacgcgagtaaatgtattggttgccgtacctgtgaagta
gcgtgcgtggtttctcatcaggaaaatcaggactgtgcatcgctgaccccggaaactttt
ttaccgcgtatccatgtcattaaaggtgtgaacatttccacggcgacagtttgccgtcag
tgtgaagatgcaccgtgcgctaacgtctgcccgaatggtgctatcagccgtgataaaggg
tttgttcatgtgatgcaggaacgttgcattggttgcaaaacctgcgttgtggcttgcccg
tatggtgcgatggaagtggtggtacgtccggtgatccgcaacagcggcgcgggtctgaat
gtacgggctgacaaagccgaagccaataaatgcgacctgtgcaaccatcgtgaagacggc
ccggcgtgtatggcggcttgcccgactcatgcgctgatttgtgtcgatcgtaataaactt
gaacaactgagcgcagaaaaacgccgccgtacggcgctgatgttctaa

DBGET integrated database retrieval system