KEGG   Escherichia coli K-12 MG1655: b2744Help
Entry
b2744             CDS       T00007                                 

Gene name
umpG
Definition
(RefSeq) broad specificity 5'(3')-nucleotidase and polyphosphatase
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco00240  Pyrimidine metabolism
eco00760  Nicotinate and nicotinamide metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    b2744 (umpG)
   00240 Pyrimidine metabolism
    b2744 (umpG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b2744 (umpG)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     b2744 (umpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-GeneID: 947211
NCBI-ProteinID: NP_417224
Pasteur: surE
RegulonDB: ECK120001750
ECOCYC: EG11817
ASAP: ABE-0009008
UniProt: P0A840 A0A387CNQ6
Position
complement(2869513..2870274)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattgctgagtaatgatgacggggtacatgcacccggtatacaaacgctggcg
aaagccttgcgtgagtttgctgacgttcaggtggtcgcccccgatcgtaaccgcagcggc
gcttcaaattctctgacactggaatcctccctgcgcacgtttacctttgaaaatggtgat
attgctgtgcaaatgggaaccccgaccgattgcgtctatcttggcgtgaatgctctgatg
cgtccgcgcccggacattgttgtgtccggaattaacgccgggccgaatctgggggatgat
gttatttattccggtacggtagccgccgcgatggaaggccgtcatttaggttttccggcg
cttgccgtctcgcttgacgggcataaacattacgacactgccgcggcggtaacctgttca
attttgcgcgcactgtgtaaagagccgctgcgcaccgggcgtattcttaatattaacgtt
ccggatttacccttggatcaaatcaaaggtattcgcgtgacgcgctgcggtacacgacat
ccggcagatcaggtgatcccgcagcaagatccgcgcggcaatacgctgtactggattggc
ccgccgggcggtaaatgtgatgctggtccggggaccgattttgctgcggtagatgagggc
tatgtctccatcacgccgctgcatgtggatttaactgcgcatagcgcgcaagatgtggtt
tcagactggttaaacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system