KEGG   Escherichia coli K-12 MG1655: b2747Help
Entry
b2747             CDS       T00007                                 

Gene name
ispD
Definition
(RefSeq) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00900  Terpenoid backbone biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
Module
eco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    b2747 (ispD)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     b2747 (ispD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 948269
NCBI-ProteinID: NP_417227
Pasteur: ygbP
RegulonDB: ECK120003988
ECOCYC: G7423
ASAP: ABE-0009017
UniProt: Q46893
Structure
PDB: 

Position
complement(2871780..2872490)
Genome map
AA seq 236 aa AA seqDB search
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactcatttggatgtttgcgccgtggttccggcggccggatttggccgtcga
atgcaaacggaatgtcctaagcaatatctctcaatcggtaatcaaaccattcttgaacac
tcggtgcatgcgctgctggcgcatccccgggtgaaacgtgtcgtcattgccataagtcct
ggcgatagccgttttgcacaacttcctctggcgaatcatccgcaaatcaccgttgtagat
ggcggtgatgagcgtgccgattccgtgctggcaggtctgaaagccgctggcgacgcgcag
tgggtattggtgcatgacgccgctcgtccttgtttgcatcaggatgacctcgcgcgattg
ttggcgttgagcgaaaccagccgcacgggggggatcctcgccgcaccagtgcgcgatact
atgaaacgtgccgaaccgggcaaaaatgccattgctcataccgttgatcgcaacggctta
tggcacgcgctgacgccgcaatttttccctcgtgagctgttacatgactgtctgacgcgc
gctctaaatgaaggcgcgactattaccgacgaagcctcggcgctggaatattgcggattc
catcctcagttggtcgaaggccgtgcggataacattaaagtcacgcgcccggaagatttg
gcactggccgagttttacctcacccgaaccatccatcaggagaatacataa

DBGET integrated database retrieval system