KEGG   Escherichia coli K-12 MG1655: b2794Help
Entry
b2794             CDS       T00007                                 

Gene name
queF
Definition
(RefSeq) 7-cyano-7-deazaguanine reductase
  KO
K06879  7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00790  Folate biosynthesis
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b2794 (queF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b2794 (queF)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     b2794 (queF)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    b2794 (queF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueF_N QueF
Motif
Other DBs
NCBI-GeneID: 947270
NCBI-ProteinID: NP_417274
Pasteur: yqcD
RegulonDB: ECK120004015
ECOCYC: G7452
ASAP: ABE-0009162
UniProt: Q46920
Position
2925348..2926196
Genome map
AA seq 282 aa AA seqDB search
MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFHGTDIWTLY
ELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLS
TCAQGKISVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFTTDYLENATCGEKVVEET
LVSHLLKSNCLITHQPDWGSLQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDL
LRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttatgcaaaccatcaggcacttgcgggcctgactcttggaaaatcaaccgat
taccgggatacctatgacgccagcctactgcaaggcgttccacgcagcctgaatcgcgac
ccgctgggtctgaaagcggataacctgccttttcacggtacggatatctggacgctgtat
gaactttcctggctgaatgcgaaaggtttgccgcaggtcgctgtcggtcatgttgaactt
gattacaccagcgtaaatctgattgagtcgaagagttttaagctctatctcaacagtttt
aaccagacgcgttttaataactgggatgaggtgcgccagacgctggagcgcgacttaagc
acttgcgctcagggtaagattagcgtggcgttatatcgtcttgatgaactggaaggccag
ccgataggtcattttaatggcacttgcattgatgaccaggatatcactatcgataactat
gaattcactactgactatctggagaatgccacctgtggtgaaaaagtagtggaagagacg
cttgtcagccacctgctgaaatcaaactgcctgatcacccatcaaccagattggggttcg
ctccaaattcagtatcgtggacgccaaattgacagagaaaaactgctgcgttacctggtc
tcattccgtcatcacaacgagttccacgaacagtgcgtggaacgcatctttaatgacctg
ttacgcttctgccagccagaaaaattgagcgtttacgcacgttatacccgtcgtggcggt
ctggacattaacccgtggcgcagtaatagcgattttgtcccatcgaccacaagactggtt
cggcaataa

DBGET integrated database retrieval system