KEGG   Escherichia coli K-12 MG1655: b2835
Entry
b2835             CDS       T00007                                 

Symbol
lplT
Name
(RefSeq) lysophospholipid transporter
  KO
K08227  MFS transporter, LPLT family, lysophospholipid transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2835 (lplT)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Lysophospholipid transporter (LplT) family [TC:2.A.1.42]
    b2835 (lplT)
SSDB
Motif
Pfam: MFS_1 DUF1427
Other DBs
NCBI-GeneID: 947317
NCBI-ProteinID: NP_417312
Pasteur: ygeD
RegulonDB: ECK120002304
ECOCYC: EG12455
ASAP: ABE-0009300
UniProt: P39196
Position
complement(2972669..2973862)
AA seq 397 aa
MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVG
AYILFAPFVGQVADSFAKGRVMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAK
YGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLADWHVLVALAACALAYGGAVVA
NIYIPKLAAARPGQSWNLINMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLV
LWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFS
LQHELLPAYALLMLIGVMGGFFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLG
IYSLAVMIGIPVVPIGIGFGALFALAITALWIWQRRH
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagtgagtcagtgcacactaacacttcgttgtggtcgaaggggatgaaagcggttatc
gtggcgcagtttctctctgcgtttggcgataatgccctactgtttgccactctggcgtta
ctgaaagcgcagttctatccggagtggagccagcccatcctgcaaatggtgtttgtaggt
gcttacattctttttgcgccgtttgtcgggcaggtggcggatagcttcgccaaaggccgg
gtgatgatgtttgccaacggcctgaagctgctgggcgcagccagtatctgctttggtatc
aatccgtttctcggctatacgctggtgggtgttggtgctgcagcctattcaccggcgaaa
tacggtattctcggcgaattaaccacgggtagtaagttagtgaaagctaacggtttaatg
gaagcttctaccatagcggcgattttgctcggttccgtagccggtggtgtgctggctgac
tggcatgtcctcgtcgccctggccgcatgcgcactggcctacggtggtgcggtcgttgcc
aatatctacattcccaaactggcggcggcgcgtccggggcagtcctggaatctcatcaac
atgacccgcagtttcctgaatgcctgcacctcgctatggcgcaatggtgaaacgcgtttt
tcgctggtgggcaccagtttattctggggagcgggtgtcacgctgcgtttcctgttggtg
ctgtgggtaccggtggcgctgggcattaccgataacgctacgcccacctatctcaacgcg
atggtagcgattggtatcgtggttggcgcaggtgcggcagcgaagttagttacgctggaa
accgtgtcacgctgtatgccagccgggattttgattggcgtggtggtactgattttttcc
ctgcaacacgagctgctgccagcctatgccttgttgatgctgattggcgtgatggggggc
ttttttgtcgttccgctcaatgcgttgctacaggagcggggtaaaaaaagcgtcggggcg
gggaatgcgattgcagtacaaaaccttggcgaaaacagcgccatgttgttgatgctgggc
atttactcgctggcggtaatgataggcatcccggtcgtgcccattggcattggcttcggt
gcgctgtttgcgctggcaataacggcgctgtggatctggcagcgccgtcattaa

DBGET integrated database retrieval system