KEGG   Escherichia coli K-12 MG1655: b2840Help
Entry
b2840             CDS       T00007                                 

Gene name
ygeA
Definition
(RefSeq) amino acid racemase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Pantoate_transf
Motif
Other DBs
NCBI-GeneID: 947348
NCBI-ProteinID: NP_417317
Pasteur: ygeA
RegulonDB: ECK120001140
ECOCYC: EG11157
ASAP: ABE-0009315
UniProt: P03813
Structure
PDB: 

Position
complement(2979943..2980635)
Genome map
AA seq 230 aa AA seqDB search
MKTIGLLGGMSWESTIPYYRLINEGIKQRLGGLHSAQVLLHSVDFHEIEECQRRGEWDKT
GDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCTLPFLHIADATGRAITGAGMTRV
ALLGTRYTMEQDFYRGRLTEQFSINCLIPEADERAKINQIIFEELCLGQFTEASRAYCAQ
VIARLAEQGAQGVIFGCTEIGLLVPEERSVLPVFDTAAIHAEDAVAFMLS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattggtttgctgggaggaatgagctgggaatccaccattccttactatcgt
ttgataaatgaaggcattaaacagcggcttggtgggcttcactctgcgcaagtgctgcta
catagcgtcgattttcatgaaatagaagagtgccagcgtcgcggggaatgggataaaacc
ggggacattctggctgaggcggcgcttggcttacagcgggcgggcgcagaaggtattgtg
ctatgtaccaatacgatgcataaagtggcggatgccattgagtcacgttgcactctgcct
ttcttacacattgcggatgccaccggacgtgcaattaccggggccggaatgactcgtgtg
gcgctgctgggtacgcgttacaccatggaacaggatttttatcgcgggcggctgacggaa
caattttccatcaattgtcttattcctgaagcggatgaacgggcgaaaattaatcagatt
atttttgaagaactgtgtctggggcaatttaccgaagcgtcacgcgcttattgtgcgcaa
gtgattgctcgccttgcagaacagggcgcacagggcgtcatttttggctgcacagaaatt
ggtttactggtgccagaagagcgcagtgttttgcctgtgtttgataccgcggcgatccat
gccgaggatgctgtcgcttttatgctgtcgtag

DBGET integrated database retrieval system