KEGG   Escherichia coli K-12 MG1655: b2841
Entry
b2841             CDS       T00007                                 

Gene name
araE
Definition
(RefSeq) arabinose:H(+) symporter
  KO
K02100  MFS transporter, SP family, arabinose:H+ symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2841 (araE)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    b2841 (araE)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12
Other DBs
NCBI-GeneID: 947341
NCBI-ProteinID: NP_417318
Pasteur: araE
RegulonDB: ECK120000052
ECOCYC: EG10056
ASAP: ABE-0009319
UniProt: P0AE24
Position
complement(2980764..2982182)
AA seq 472 aa
MVTINTESALTPRSLRDTRRMNMFVSVAAAVAGLLFGLDIGVIAGALPFITDHFVLTSRL
QEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARV
VLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAM
LGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVLRMLRDTSEKAREELNEIRESLK
LKQGGWALFKINRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIAT
LVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWL
SVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLD
SIGAAGTFWLYTALNIAFVGITFWLIPETKNVTLEHIERKLMAGEKLRNIGV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggttactatcaatacggaatctgctttaacgccacgttctttgcgggatacgcggcgt
atgaatatgtttgtttcggtagctgctgcggtcgcaggattgttatttggtcttgatatc
ggcgtaatcgccggagcgttgccgttcattaccgatcactttgtgctgaccagtcgtttg
caggaatgggtggttagtagcatgatgctcggtgcagcaattggtgcgctgtttaatggt
tggctgtcgttccgcctggggcgtaaatacagcctgatggcgggggccatcctgtttgta
ctcggttctatagggtccgcttttgcgaccagcgtagagatgttaatcgccgctcgtgtg
gtgctgggcattgctgtcgggatcgcgtcttacaccgctcctctgtatctttctgaaatg
gcaagtgaaaacgttcgcggtaagatgatcagtatgtaccagttgatggtcacactcggc
atcgtgctggcgtttttatccgatacagcgttcagttatagcggtaactggcgcgcaatg
ttgggggttcttgctttaccagcagttctgctgattattctggtagtcttcctgccaaat
agcccgcgctggctggcggaaaaggggcgtcatattgaggcggaagaagtattgcgtatg
ctgcgcgatacgtcggaaaaagcgcgagaagaactcaacgaaattcgtgaaagcctgaag
ttaaaacagggcggttgggcactgtttaagatcaaccgtaacgtccgtcgtgctgtgttt
ctcggtatgttgttgcaggcgatgcagcagtttaccggtatgaacatcatcatgtactac
gcgccgcgtatcttcaaaatggcgggctttacgaccacagaacaacagatgattgcgact
ctggtcgtagggctgacctttatgttcgccacctttattgcggtgtttacggtagataaa
gcagggcgtaaaccggctctgaaaattggtttcagcgtgatggcgttaggcactctggtg
ctgggctattgcctgatgcagtttgataacggtacggcttccagtggcttgtcctggctc
tctgttggcatgacgatgatgtgtattgccggttatgcgatgagcgccgcgccagtggtg
tggatcctgtgctctgaaattcagccgctgaaatgccgcgatttcggtattacctgttcg
accaccacgaactgggtgtcgaatatgattatcggcgcgaccttcctgacactgcttgat
agcattggcgctgccggtacgttctggctctacactgcgctgaacattgcgtttgtgggc
attactttctggctcattccggaaaccaaaaatgtcacgctggaacatatcgaacgcaaa
ctgatggcaggcgagaagttgagaaatatcggcgtctga

DBGET integrated database retrieval system