KEGG   Escherichia coli K-12 MG1655: b2918Help
Entry
b2918             CDS       T00007                                 

Gene name
argK
Definition
(RefSeq) methylmalonyl-CoA mutase-interacting GTPase YgfD
  KO
K07588  LAO/AO transport system kinase [EC:2.7.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b2918 (argK)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     b2918 (argK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MeaB cobW CbiA IstB_IS21 ATP_bind_1 AAA_29 AAA_30 AAA_22 AAA_24 NTPase_1 ATPase AAA_18 PRK MobB DNA_photolyase ArsA_ATPase ABC_tran
Motif
Other DBs
NCBI-GeneID: 947412
NCBI-ProteinID: NP_417393
Pasteur: argK
RegulonDB: ECK120001409
ECOCYC: EG11445
ASAP: ABE-0009579
UniProt: P27254
Structure
PDB: 

Position
3062987..3063982
Genome map
AA seq 331 aa AA seqDB search
MINEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLGVT
GTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIR
PVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQIAGGG
DDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMYESALHILRRKYDEWQPRVLTCSA
LEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEDFDRYY
RQTLLAVKNNTLSPRTGLRQLSEFIQTQYFD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgaagccacgctggcagaaagtattcgccgcttacgtcagggtgagcgtgcc
acactcgcccaggccatgacgctggtggaaagccgtcacccgcgtcatcaggcactaagt
acgcagctgcttgatgccattatgccgtactgcggtaacaccctgcgactgggcgttacc
ggcacccccggcgcggggaaaagtacctttcttgaggcctttggcatgttgttgattcga
gagggattaaaggtcgcggttattgcggtcgatcccagcagcccggtcactggcggtagc
attctcggggataaaacccgcatgaatgacctggcgcgtgccgaagcggcgtttattcgc
ccggtaccatcctccggtcatctgggcggtgccagtcagcgagcgcgggaattaatgctg
ttatgcgaagcagcgggttatgacgtagtgattgtcgaaacggttggcgtcgggcagtcg
gaaacagaagtcgcccgcatggtggactgttttatctcgttgcaaattgccggtggcggc
gatgatctgcagggcattaaaaaagggctgatggaagtggctgatctgatcgttatcaac
aaagacgatggcgataaccataccaatgtcgccattgcccggcatatgtacgagagtgcc
ctgcatattctgcgacgtaaatacgacgaatggcagccacgggttctgacttgtagcgca
ctggaaaaacgtggaatcgatgagatctggcacgccatcatcgacttcaaaaccgcgcta
actgccagtggtcgtttacaacaagtgcggcaacaacaatcggtggaatggctgcgtaag
cagaccgaagaagaagtactgaatcacctgttcgcgaatgaagatttcgatcgctattac
cgccagacgcttttagcggtcaaaaacaatacgctctcaccgcgcaccggcctgcggcag
ctcagtgaatttatccagacgcaatattttgattaa

DBGET integrated database retrieval system