KEGG   Escherichia coli K-12 MG1655: b2925Help
Entry
b2925             CDS       T00007                                 

Gene name
fbaA
Definition
(RefSeq) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00030  Pentose phosphate pathway
eco00051  Fructose and mannose metabolism
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b2925 (fbaA)
   00030 Pentose phosphate pathway
    b2925 (fbaA)
   00051 Fructose and mannose metabolism
    b2925 (fbaA)
  Energy metabolism
   00680 Methane metabolism
    b2925 (fbaA)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     b2925 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase S-methyl_trans
Motif
Other DBs
NCBI-GeneID: 947415
NCBI-ProteinID: NP_417400
Pasteur: fbaA
RegulonDB: ECK120000276
ECOCYC: EG10282
ASAP: ABE-0009600
UniProt: P0AB71
Structure
PDB: 

Position
complement(3070165..3071244)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatttttgatttcgtaaaacctggcgtaatcactggtgatgacgtacagaaa
gttttccaggtagcaaaagaaaacaacttcgcactgccagcagtaaactgcgtcggtact
gactccatcaacgccgtactggaaaccgctgctaaagttaaagcgccggttatcgttcag
ttctccaacggtggtgcttcctttatcgctggtaaaggcgtgaaatctgacgttccgcag
ggtgctgctatcctgggcgcgatctctggtgcgcatcacgttcaccagatggctgaacat
tatggtgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgttggacgcgggtgaaaaacacttcgcagctaccggtaagccgctgttctct
tctcacatgatcgacctgtctgaagaatctctgcaagagaacatcgaaatctgctctaaa
tacctggagcgcatgtccaaaatcggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgcactgtacacccagccg
gaagacgttgattacgcatacaccgaactgagcaaaatcagcccgcgtttcaccatcgca
gcgtccttcggtaacgtacacggtgtttacaagccgggtaacgtggttctgactccgacc
atcctgcgtgattctcaggaatatgtttccaagaaacacaacctgccgcacaacagcctg
aacttcgtattccacggtggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtaaaaatgaacatcgataccgatacccaatgggcaacctgggaaggcgtt
ctgaactactacaaagcgaacgaagcttatctgcagggtcagctgggtaacccgaaaggc
gaagatcagccgaacaagaaatactacgatccgcgcgtatggctgcgtgccggtcagact
tcgatgatcgctcgtctggagaaagcattccaggaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system