KEGG   Escherichia coli K-12 MG1655: b2935
Entry
b2935             CDS       T00007                                 

Gene name
tktA
Definition
(RefSeq) transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00030  Pentose phosphate pathway
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    b2935 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    b2935 (tktA)
Enzymes [BR:eco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     b2935 (tktA)
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Other DBs
NCBI-GeneID: 947420
NCBI-ProteinID: YP_026188
Pasteur: tktA
RegulonDB: ECK120001391
ECOCYC: EG11427
ASAP: ABE-0009625
UniProt: P27302
Structure
PDB: 

Position
complement(3079644..3081635)
AA seq 663 aa
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPQNPSWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVEGWFTDDTAMRFEAYGWHVIRDIDGHDAASIKRAVEEARAVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAG
QAKESAWNEKFAAYAKAYPQEAAEFTRRMKGEMPSDFDAKAKEFIAKLQANPAKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
ISLHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVA
SLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQNLAQQERTEEQLANIARGG
YVLKDCAGQPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESV
LPKAVTARVAVEAGIADYWYKYVGLNGAIVGMTTFGESAPAELLFEEFGFTVDNVVAKAK
ELL
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtcctcacgtaaagagcttgccaatgctattcgtgcgctgagcatggacgcagtacag
aaagccaaatccggtcacccgggtgcccctatgggtatggctgacattgccgaagtcctg
tggcgtgatttcctgaaacacaacccgcagaatccgtcctgggctgaccgtgaccgcttc
gtgctgtccaacggccacggctccatgctgatctacagcctgctgcacctcaccggttac
gatctgccgatggaagaactgaaaaacttccgtcagctgcactctaaaactccgggtcac
ccggaagtgggttacaccgctggtgtggaaaccaccaccggtccgctgggtcagggtatt
gccaacgcagtcggtatggcgattgcagaaaaaacgctggcggcgcagtttaaccgtccg
ggccacgacattgtcgaccactacacctacgccttcatgggcgacggctgcatgatggaa
ggcatctcccacgaagtttgctctctggcgggtacgctgaagctgggtaaactgattgca
ttctacgatgacaacggtatttctatcgatggtcacgttgaaggctggttcaccgacgac
accgcaatgcgtttcgaagcttacggctggcacgttattcgcgacatcgacggtcatgac
gcggcatctatcaaacgcgcagtagaagaagcgcgcgcagtgactgacaaaccttccctg
ctgatgtgcaaaaccatcatcggtttcggttccccgaacaaagccggtacccacgactcc
cacggtgcgccgctgggcgacgctgaaattgccctgacccgcgaacaactgggctggaaa
tatgcgccgttcgaaatcccgtctgaaatctatgctcagtgggatgcgaaagaagcaggc
caggcgaaagaatccgcatggaacgagaaattcgctgcttacgcgaaagcttatccgcag
gaagccgctgaatttacccgccgtatgaaaggcgaaatgccgtctgacttcgacgctaaa
gcgaaagagttcatcgctaaactgcaggctaatccggcgaaaatcgccagccgtaaagcg
tctcagaatgctatcgaagcgttcggtccgctgttgccggaattcctcggcggttctgct
gacctggcgccgtctaacctgaccctgtggtctggttctaaagcaatcaacgaagatgct
gcgggtaactacatccactacggtgttcgcgagttcggtatgaccgcgattgctaacggt
atctccctgcacggtggcttcctgccgtacacctccaccttcctgatgttcgtggaatac
gcacgtaacgccgtacgtatggctgcgctgatgaaacagcgtcaggtgatggtttacacc
cacgactccatcggtctgggcgaagacggcccgactcaccagccggttgagcaggtcgct
tctctgcgcgtaaccccgaacatgtctacatggcgtccgtgtgaccaggttgaatccgcg
gtcgcgtggaaatacggtgttgagcgtcaggacggcccgaccgcactgatcctctcccgt
cagaacctggcgcagcaggaacgaactgaagagcaactggcaaacatcgcgcgcggtggt
tatgtgctgaaagactgcgccggtcagccggaactgattttcatcgctaccggttcagaa
gttgaactggctgttgctgcctacgaaaaactgactgccgaaggcgtgaaagcgcgcgtg
gtgtccatgccgtctaccgacgcatttgacaagcaggatgctgcttaccgtgaatccgta
ctgccgaaagcggttactgcacgcgttgctgtagaagcgggtattgctgactactggtac
aagtatgttggcctgaacggtgctatcgtcggtatgaccaccttcggtgaatctgctccg
gcagagctgctgtttgaagagttcggcttcactgttgataacgttgttgcgaaagcaaaa
gaactgctgtaa

DBGET integrated database retrieval system