KEGG   Escherichia coli K-12 MG1655: b2943Help
Entry
b2943             CDS       T00007                                 

Gene name
galP
Definition
(RefSeq) galactose:H(+) symporter
  KO
K08137  MFS transporter, SP family, galactose:H+ symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b2943 (galP)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    b2943 (galP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2 SHR3_chaperone MFS_1_like MFS_4
Motif
Other DBs
NCBI-GeneID: 947434
NCBI-ProteinID: NP_417418
Pasteur: galP
RegulonDB: ECK120002048
ECOCYC: EG12148
ASAP: ABE-0009654
UniProt: P0AEP1
Position
3088284..3089678
Genome map
AA seq 464 aa AA seqDB search
MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSS
MMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVG
VASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIP
AILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWA
LFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTN
VLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIV
GFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWV
YAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgctaaaaaacaggggcggtcaaacaaggcaatgacgtttttcgtctgcttc
cttgccgctctggcgggattactctttggcctggatatcggtgtaattgctggcgcactg
ccgtttattgcagatgaattccagattacttcgcacacgcaagaatgggtcgtaagctcc
atgatgttcggtgcggcagtcggtgcggtgggcagcggctggctctcctttaaactcggg
cgcaaaaagagcctgatgatcggcgcaattttgtttgttgccggttcgctgttctctgcg
gctgcgccaaacgttgaagtactgattctttcccgcgttctactggggctggcggtgggt
gtggcctcttataccgcaccgctgtacctctctgaaattgcgccggaaaaaattcgtggc
agtatgatctcgatgtatcagttgatgatcactatcgggatcctcggtgcttatctttct
gataccgccttcagctacaccggtgcatggcgctggatgctgggtgtgattatcatcccg
gcaattttgctgctgattggtgtcttcttcctgccagacagcccacgttggtttgccgcc
aaacgccgttttgttgatgccgaacgcgtgctgctacgcctgcgtgacaccagcgcggaa
gcgaaacgcgaactggatgaaatccgtgaaagtttgcaggttaaacagagtggctgggcg
ctgtttaaagagaacagcaacttccgccgcgcggtgttccttggcgtactgttgcaggta
atgcagcaattcaccgggatgaacgtcatcatgtattacgcgccgaaaatcttcgaactg
gcgggttataccaacactaccgagcaaatgtgggggaccgtgattgtcggcctgaccaac
gtacttgccacctttatcgcaatcggccttgttgaccgctggggacgtaaaccaacgcta
acgctgggcttcctggtgatggctgctggcatgggcgtactcggtacaatgatgcatatc
ggtattcactctccgtcggcgcagtatttcgccatcgccatgctgctgatgtttattgtc
ggttttgccatgagtgccggtccgctgatttgggtactgtgctccgaaattcagccgctg
aaaggccgcgattttggcatcacctgctccactgccaccaactggattgccaacatgatc
gttggcgcaacgttcctgaccatgctcaacacgctgggtaacgccaacaccttctgggtg
tatgcggctctgaacgtactgtttatcctgctgacattgtggctggtaccggaaaccaaa
cacgtttcgctggaacatattgaacgtaatctgatgaaaggtcgtaaactgcgcgaaata
ggcgctcacgattaa

DBGET integrated database retrieval system