KEGG   Escherichia coli K-12 MG1655: b2988Help
Entry
b2988             CDS       T00007                                 

Gene name
gss
Definition
(RefSeq) fused glutathionylspermidine amidase/glutathionylspermidine synthetase
  KO
K01460  glutathionylspermidine amidase/synthetase [EC:3.5.1.78 6.3.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00480  Glutathione metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    b2988 (gss)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.78  glutathionylspermidine amidase
     b2988 (gss)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.8  glutathionylspermidine synthase
     b2988 (gss)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSP_synth CHAP
Motif
Other DBs
NCBI-GeneID: 947474
NCBI-ProteinID: NP_417462
Pasteur: gsp
RegulonDB: ECK120002421
ECOCYC: EG12882
ASAP: ABE-0009804
UniProt: P0AES0 A0A387D098
Structure
PDB: 

Position
complement(3136663..3138522)
Genome map
AA seq 619 aa AA seqDB search
MSKGTTSQDAPFGTLLGYAPGGVAIYSSDYSSLDPQEYEDDAVFRSYIDDEYMGHKWQCV
EFARRFLFLNYGVVFTDVGMAWEIFSLRFLREVVNDNILPLQAFPNGSPRAPVAGALLIW
DKGGEFKDTGHVAIITQLHGNKVRIAEQNVIHSPLPQGQQWTRELEMVVENGCYTLKDTF
DDTTILGWMIQTEDTEYSLPQPEIAGELLKISGARLENKGQFDGKWLDEKDPLQNAYVQA
NGQVINQDPYHYYTITESAEQELIKATNELHLMYLHATDKVLKDDNLLALFDIPKILWPR
LRLSWQRRRHHMITGRMDFCMDERGLKVYEYNADSASCHTEAGLILERWAEQGYKGNGFN
PAEGLINELAGAWKHSRARPFVHIMQDKDIEENYHAQFMEQALHQAGFETRILRGLDELG
WDAAGQLIDGEGRLVNCVWKTWAWETAFDQIREVSDREFAAVPIRTGHPQNEVRLIDVLL
RPEVLVFEPLWTVIPGNKAILPILWSLFPHHRYLLDTDFTVNDELVKTGYAVKPIAGRCG
SNIDLVSHHEEVLDKTSGKFAEQKNIYQQLWCLPKVDGKYIQVCTFTVGGNYGGTCLRGD
ESLVIKKESDIEPLIVVKK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggaacgaccagccaggatgccccgttcgggacattattgggctacgcccca
ggtggggtagcaatctactcttcagattacagttctctcgatccgcaggaatacgaagat
gacgccgtattccgtagctatatcgacgacgaatatatgggccacaagtggcaatgcgtt
gaatttgctcgccgttttctctttctgaattacggtgtggtctttactgacgtgggtatg
gcgtgggagattttctcgctgcgcttcctgcgagaagtggttaatgacaacatcctgcca
ttgcaggcatttcctaacggctcgccgcgtgcgccggtcgcgggtgcgcttcttatctgg
gataaaggcggtgaatttaaagacactggccatgtcgccatcattacccaattgcatggc
aacaaagtccgtattgcggaacagaacgtgattcattccccgttgccgcaagggcaacag
tggacgcgcgagctggagatggtggtcgaaaacggctgctataccctgaaagacactttt
gatgacaccaccattctgggctggatgatccagacggaagatactgaatacagcttaccg
cagccggaaattgcaggcgagctgctgaaaatcagcggagcgcgcctggaaaacaaaggc
cagtttgacggtaaatggctggatgaaaaagatccgctgcaaaacgcctatgtgcaggcc
aacggtcaggtgatcaatcaggatccttatcattactacaccattaccgagagtgccgag
caggagctaattaaagccaccaacgagctgcacctgatgtatcttcacgcaaccgacaag
gtgctgaaagatgacaacctgctggcgctgttcgacatcccgaaaatcctctggccacgt
ttgcgtctctcctggcagcgtcgccgtcaccatatgatcactggtcgtatggatttctgc
atggatgagcgtggcctgaaggtttacgagtacaacgccgactccgcctcctgtcatacc
gaagcgggcttgatcctcgaacgttgggcggagcagggctataaaggcaacggcttcaat
ccggcggaagggctgattaacgaattggctggtgcctggaaacacagtcgtgcacgtccg
tttgtccatatcatgcaggacaaagatatcgaggaaaactatcacgcgcagtttatggag
caggcgctgcaccaggcgggctttgaaacgcgtatcttgcgtggattggatgaactgggc
tgggatgctgccgggcaactgattgatggggaagggcgactggttaactgcgtgtggaaa
acctgggcgtgggaaaccgcgtttgatcagattcgtgaagttagcgaccgtgagtttgct
gcggtgccaatccgtaccggtcatccgcaaaacgaagtgcgtcttatcgacgtattgctg
cgcccggaagtgctggtctttgagccgctgtggacggtgatccccggcaacaaagcgatt
ctgccgatcctctggtcgctgttcccgcaccatcgttacctgctggataccgatttcact
gttaatgatgaactggtgaaaacaggttacgcagtgaaaccgatcgccggtcgctgtggc
agcaatatcgacctcgtcagccatcatgaagaggtgctggacaaaaccagcggtaaattt
gccgagcagaaaaacatctatcagcaactgtggtgtttgccgaaagtggacggtaaatac
attcaggtatgtaccttcaccgttggcggcaactacggtgggacgtgtttgcgcggtgat
gaatcactggtcatcaaaaaagagagtgatattgaaccgttaattgtggtgaaaaagtaa

DBGET integrated database retrieval system