KEGG   Escherichia coli K-12 MG1655: b3009Help
Entry
b3009             CDS       T00007                                 

Gene name
yghB
Definition
(RefSeq) DedA family protein YghB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-GeneID: 947490
NCBI-ProteinID: NP_417482
Pasteur: yghB
RegulonDB: ECK120001756
ECOCYC: EG11824
ASAP: ABE-0009882
UniProt: P0AA60 A0A387CX83
Position
3153563..3154222
Genome map
AA seq 219 aa AA seqDB search
MAVIQDIIAALWQHDFAALADPHIVSVVYFVMFATLFLENGLLPASFLPGDSLLILAGAL
IAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLAQLPAKYHQRATCMFDR
HGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLLWVSVVTSFGYALSMIPF
VKRHEDQVMTFLMILPIALLTAGLLGTLFVVIKKKYCNA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctgttattcaagatatcatcgctgcgctctggcaacacgactttgccgcgctggcg
gatcctcatattgttagcgttgtttactttgtcatgtttgccacgctgtttttagaaaac
ggcctgctgcccgcctcatttttgccaggcgacagcttgttgatactggcaggcgcattg
attgcccagggggttatggattttctgcctacgattgcgattctgaccgccgcagcaagt
ctgggctgctggctaagttatattcaggggcgctggttagggaataccaaaacggtgaaa
ggctggctggcacagcttcctgctaaatatcaccagcgcgccacctgcatgtttgaccgc
cacggtctgctggcgctgctggctggacgttttcttgcatttgtccgtacgctgctgcca
accatggcgggaatttccggtctgccaaaccgccgcttccagtttttcaactggttaagt
ggattgctgtgggtcagcgtggtaaccagttttggctatgccttaagtatgattccgttc
gttaaacgccatgaagatcaggtaatgacgttcctgatgatcctgccaattgccttgtta
accgctggcttgttaggcacgctgtttgtggtgattaaaaaaaaatactgtaacgcctga

DBGET integrated database retrieval system