KEGG   Escherichia coli K-12 MG1655: b3019Help
Entry
b3019             CDS       T00007                                 

Gene name
parC
Definition
(RefSeq) DNA topoisomerase IV, subunit A
  KO
K02621  topoisomerase IV subunit A [EC:5.99.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b3019 (parC)
   03036 Chromosome and associated proteins [BR:eco03036]
    b3019 (parC)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:eco02048]
    b3019 (parC)
Enzymes [BR:eco01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     b3019 (parC)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Topoisomerases
   b3019 (parC)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    b3019 (parC)
Prokaryotic defense system [BR:eco02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    b3019 (parC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C DUF4890
Motif
Other DBs
NCBI-GeneID: 947499
NCBI-ProteinID: NP_417491
Pasteur: parC
RegulonDB: ECK120000679
ECOCYC: EG10686
ASAP: ABE-0009916
UniProt: P0AFI2
Structure
PDB: 

Position
complement(3163715..3165973)
Genome map
AA seq 752 aa AA seqDB search
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVR
MRAVWKKEDGAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILEL
KLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDDRRSPL
QEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSN
QPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLLMASDA
GYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDL
PQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLTIHVGKRKIKLRPEELQKVTGE
RGRRGTLMRGLQRIDRVEIDSPRRASSGDSEE
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatggcagagcgccttgcgctacatgaatttacggaaaacgcctacttaaac
tactccatgtacgtgatcatggaccgtgcgttgccgtttattggtgatggtctgaaacct
gttcagcgccgcattgtgtatgcgatgtctgaactgggcctgaatgccagcgccaaattt
aaaaaatcggcccgtaccgtcggtgacgtactgggtaaataccatccgcacggcgatagc
gcctgttatgaagcgatggtcctgatggcgcaaccgttctcttaccgttatccgctggtt
gatggtcaggggaactggggcgcgccggacgatccgaaatcgttcgcggcaatgcgttac
accgaatcccggttgtcgaaatattccgagctgctattgagcgagctggggcaggggacg
gctgactgggtgccaaacttcgacggcactttgcaggagccgaaaatgctacctgcccgt
ctgccaaacattttgcttaacggcaccaccggtattgccgtcggcatggcgaccgatatt
ccaccgcataacctgcgtgaagtggctcaggcggcaatcgcattaatcgaccagccgaaa
accacgctcgatcagctgctggatatcgtgcaggggccggattatccgactgaagcggaa
attatcacttcgcgcgccgagatccgtaaaatctacgagaacggacgtggttcagtgcgt
atgcgcgcggtgtggaagaaagaagatggcgcggtggttatcagcgcattgccgcatcag
gtttcaggtgcgcgcgtactggagcaaattgctgcgcaaatgcgcaacaaaaagctgccg
atggttgacgatctgcgcgatgaatctgaccacgagaacccgacccgcctggtgattgtg
ccgcgttccaaccgcgtggatatggatcaggtgatgaaccacctcttcgctaccaccgat
ctggaaaagagctatcgtattaaccttaatatgatcggtctggatggtcgtccggcggtg
aaaaacctgctggaaatcctctccgaatggctggtgttccgccgcgataccgtgcgccgc
cgactgaactatcgtctggagaaagtcctcaagcgcctgcatatcctcgaaggtttgctg
gtggcgtttctcaatatcgacgaagtgattgagatcattcgtaatgaagatgaaccgaaa
ccggcgctgatgtcgcggtttggccttacggaaacccaggcggaagcgatcctcgaactg
aaactgcgtcatcttgccaaactggaagagatgaagattcgcggtgagcagagtgaactg
gaaaaagagcgcgaccagttgcagggcattttggcttccgagcgtaaaatgaataacctg
ctgaagaaagaactgcaggcagacgcgcaagcctacggtgacgatcgtcgttcgccgttg
caggaacgcgaagaagcgaaagcgatgagcgagcacgacatgctgccgtctgaacctgtc
accattgtgctgtcgcagatgggctgggtacgcagcgctaaaggccatgatatcgacgcg
ccgggcctgaattataaagcgggtgatagcttcaaagcggcggtgaaaggtaagagcaac
caaccggtagtgtttgttgattccaccggtcgtagctatgccattgacccgattacgctg
ccgtcggcgcgtggtcagggcgagccgctcaccggcaaattaacgttgccgcctggggcg
accgttgaccatatgctgatggaaagcgacgatcagaaactgctgatggcttccgatgcg
ggttacggtttcgtctgcacctttaacgatctggtggcgcgtaaccgtgcaggtaaggct
ttgatcaccttaccggaaaatgcccatgttatgccgccggtggtgattgaagatgcttcc
gatatgctgctggcaatcactcaggcaggccgtatgttgatgttcccggtaagtgatctg
ccgcagctgtcgaagggcaaaggcaacaagattatcaacattccatcggcagaagccgcg
cgtggagaagatggtctggcgcaattgtacgttctgccgccgcaaagcacgctgaccatt
catgttgggaaacgcaaaattaaactgcgcccggaagagttacagaaagtcactggcgaa
cgtggacgccgcggtacgttgatgcgcggtttgcagcgtatcgatcgtgttgagatcgac
tctcctcgccgtgccagcagcggtgatagcgaagagtaa

DBGET integrated database retrieval system