KEGG   Escherichia coli K-12 MG1655: b3021Help
Entry
b3021             CDS       T00007                                 

Gene name
mqsA
Definition
(RefSeq) antitoxin of the MqsRA toxin-antitoxin system/DNA-binding transcriptional repressor MqsA
  KO
K13655  HTH-type transcriptional regulator / antitoxin MqsA
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b3021 (mqsA)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eco02048]
    b3021 (mqsA)
Transcription factors [BR:eco03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    b3021 (mqsA)
Prokaryotic defense system [BR:eco02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MqsR-MqsA
    b3021 (mqsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MqsA_antitoxin HTH_3 HTH_31 Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 945814
NCBI-ProteinID: NP_417493
Pasteur: ygiT
RegulonDB: ECK120004129
ECOCYC: G7571
ASAP: ABE-0009923
UniProt: Q46864
Structure
PDB: 

Position
complement(3167851..3168246)
Genome map
AA seq 131 aa AA seqDB search
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAF
RASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVL
DKHPELLNEIR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtccggtttgccaccagggagaaatggtttctggcattaaagatattccatac
accttccgtggacgaaaaacagtattgaaaggtatccacggtttatattgtgtccattgc
gaagagagcatcatgaataaagaagagtcagatgctttcatggcgcaagtaaaggcattt
cgggcttcggtgaatgccgaaacagtggcacctgaatttatagtgaaggttcgaaaaaag
ctctctcttacccaaaaagaggcaagcgaaatttttgggggaggtgtaaatgcgttttcg
cgttacgaaaaaggcaatgcccaacctcatccttccacaatcaaacttttacgtgttctg
gataagcatccagaactattgaatgaaatccgttaa

DBGET integrated database retrieval system