KEGG   Escherichia coli K-12 MG1655: b3023Help
Entry
b3023             CDS       T00007                                 

Gene name
ygiV
Definition
(RefSeq) transcriptional repressor for mcbR biofilm gene
  KO
K07471  probable transcriptional regulator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    b3023 (ygiV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GyrI-like Cass2
Motif
Other DBs
NCBI-GeneID: 945805
NCBI-ProteinID: YP_026197
Pasteur: ygiV
RegulonDB: ECK120004131
ECOCYC: G7573
ASAP: ABE-0009928
UniProt: Q46866
Position
complement(3168749..3169231)
Genome map
AA seq 160 aa AA seqDB search
MTNLTLDVNIIDFPSIPVAMLPHRCSPELLNYSVAKFIMWRKETGLSPVNQSQTFGVAWD
DPATTAPEAFRFDICGSVSEPIPDNRYGVSNGELTGGRYAVARHVGELDDISHTVWGIIR
HWLPASGEKMRKAPILFHYTNLAEGVTEQRLETDVYVPLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacctgacactggatgtaaacattatcgatttcccatcaatacctgtggcgatg
ttgccgcaccgctgtagccctgaattgctcaactacagcgtggcgaaatttatcatgtgg
cgtaaagagacggggctttctcctgttaaccaaagccagacttttggcgtcgcctgggac
gaccctgccaccaccgcaccggaagcgtttcgctttgatatctgcggcagcgttagcgaa
ccgattcccgataatcgttatggtgtgagcaatggtgaacttaccggtggacgttatgcc
gtggcccgccacgttggcgagctggacgatatttcacacacggtatggggcatcattcgc
cactggctgcctgcaagcggcgagaaaatgcgtaaagcaccgattctgtttcactacacc
aatcttgccgaaggggtgacagagcagcgactggaaacggatgtttatgtgccgttggcg
tga

DBGET integrated database retrieval system