KEGG   Escherichia coli K-12 MG1655: b3029
Entry
b3029             CDS       T00007                                 
Symbol
ygiN
Name
(RefSeq) putative quinol monooxygenase YgiN
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: ABM
Other DBs
NCBI-GeneID: 947506
NCBI-ProteinID: NP_417501
Pasteur: ygiN
RegulonDB: ECK120002347
ECOCYC: EG12657
ASAP: ABE-0009948
UniProt: P0ADU2
Structure
Position
3173142..3173456
AA seq 104 aa
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSI
VMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPGI
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcttaccgtaatcgcagaaatccgtactcgtcctggtcaacatcaccgtcaggcggta
ttggatcagtttgctaaaatcgttccaaccgtactgaaagaagaaggttgccacggctat
gcgccaatggtggattgcgcagctggcgtgagtttccagtctatggcaccggattctatc
gtgatgattgagcagtgggaaagcatcgcgcatcttgaagcgcatctgcaaaccccgcac
atgaaggcgtatagcgaagccgtaaaaggtgacgtgctggagatgaatatccgtattctg
cagccagggatttaa

DBGET integrated database retrieval system