KEGG   Escherichia coli K-12 MG1655: b3066Help
Entry
b3066             CDS       T00007                                 

Gene name
dnaG
Definition
(RefSeq) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03030  DNA replication
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    b3066 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b3066 (dnaG)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     b3066 (dnaG)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    b3066 (dnaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_N zf-CHC2 DnaG_DnaB_bind Toprim_2 Toprim_4 DnaB_bind Toprim Toprim_3
Motif
Other DBs
NCBI-GeneID: 947570
NCBI-ProteinID: NP_417538
Pasteur: dnaG
RegulonDB: ECK120000233
ECOCYC: EG10239
ASAP: ABE-0010065
UniProt: P0ABS5 A0A387CSU0
Structure
PDB: 

Position
3211107..3212852
Genome map
AA seq 581 aa AA seqDB search
MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYH
CFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAGSGPSQIERHQRQTLYQLM
DGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQ
SLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFH
KGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRA
TNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEA
RMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLG
ILDDSQLERLMPKAAESGVSRPVPQLKRTTMRILIGLLVQNPELATLVPPLENLDENKLP
GLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLN
HMFDSLLELRQEELIARERTHGLSNEERLELWTLNQELAKK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggctggacgaatcccacgcgtattcattaatgatctgctggcacgcactgacatcgtc
gatctgatcgatgcccgtgtgaagctgaaaaagcagggcaagaatttccacgcgtgttgt
ccattccacaacgagaaaaccccgtccttcaccgttaacggtgagaaacagttttaccac
tgctttggatgtggcgcgcacggcaacgcgatcgacttcctgatgaactacgacaagctc
gagttcgtcgaaacggtcgaagagctggcagcaatgcacaatcttgaagtgccatttgaa
gcaggcagcggccccagccagatcgagcgccatcagaggcaaacgctttatcagttgatg
gacggtctgaatacgttttaccaacaatctttacaacaacctgttgccacgtctgcgcgc
cagtatctggaaaaacgcggattaagccacgaggttatcgctcgctttgcgattggtttt
gcgccccccggctgggacaacgtcctgaagcggtttggcggcaatccagaaaatcgccag
tcattgattgatgcggggatgttggtcactaacgatcagggacgcagttacgatcgtttc
cgcgagcgggtgatgttccccattcgcgataaacgcggtcgggtgattggttttggcggg
cgcgtgctgggcaacgatacccccaaatacctgaactcgccggaaacagacattttccat
aaaggccgccagctttacggtctttatgaagcgcagcaggataacgctgaacccaatcgt
ctgcttgtggtcgaaggctatatggacgtggtggcgctggcgcaatacggcattaattac
gccgttgcgtcgttaggtacgtcaaccaccgccgatcacatacaactgttgttccgcgcg
accaacaatgtcatttgctgttatgacggcgaccgtgcaggccgcgatgccgcctggcga
gcgctggaaacggcgctgccttacatgacagacggccgtcagctacgctttatgtttttg
cctgatggcgaagaccctgacacgctagtacgaaaagaaggtaaagaagcgtttgaagcg
cggatggagcaggcgatgccactctccgcatttctgtttaacagtctgatgccgcaagtt
gatctgagtacccctgacgggcgcgcacgtttgagtacgctggcactaccattgatatcg
caagtgccgggcgaaacgctgcgaatatatcttcgtcaggaattaggcaacaaattaggc
atacttgatgacagccagcttgaacgattaatgccaaaagcggcagagagcggcgtttct
cgccctgttccgcagctaaaacgcacgaccatgcgtatacttatagggttgctggtgcaa
aatccagaattagcgacgttggtcccgccgcttgagaatctggatgaaaataagctccct
ggacttggcttattcagagaactggtcaacacttgtctctcccagccaggtctgaccacc
gggcaacttttagagcactatcgtggtacaaataatgctgccacccttgaaaaactgtcg
atgtgggacgatatagcagataagaatattgctgagcaaaccttcaccgactcactcaac
catatgtttgattcgctgcttgaactgcgccaggaagagttaatcgctcgtgagcgcacg
catggtttaagcaacgaagaacgcctggagctctggacattaaaccaggagctggcgaaa
aagtga

DBGET integrated database retrieval system