KEGG   Escherichia coli K-12 MG1655: b3085
Entry
b3085             CDS       T00007                                 

Gene name
ygjP
Definition
(RefSeq) putative metal-dependent hydrolase
  KO
K07043  UTP pyrophosphatase [EC:3.6.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b3085 (ygjP)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     b3085 (ygjP)
SSDB
Motif
Pfam: DUF45 WLM T4_Rnl2_C
Other DBs
NCBI-GeneID: 947650
NCBI-ProteinID: NP_417556
RegulonDB: ECK120004157
ECOCYC: G7604
ASAP: ABE-0010138
UniProt: P42597
Position
3235960..3236463
AA seq 167 aa
MSNLTYLQGYPEQLLSQVRTLINEQRLGDVLAKRYPGTHDYATDKALWQYTQDLKNQFLR
NAPPINKVMYDNKIHVLKNALGLHTAVSRVQGGKLKAKVEIRVATVFRNAPEPFLRMIVV
HELAHLKEKEHNKAFYQLCCHMEPQYHQLEFDTRLWLTQLSLGQNKI
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaatcttacttatcttcagggttatcccgagcagctactttcccaggtgcgaaca
ctgattaacgaacagcgtctgggcgatgtgctggcaaaacgctatccgggaacacacgac
tacgccaccgataaagccctctggcaatatactcaggatctgaaaaatcagtttctgcgt
aatgccccgccgatcaataaagtgatgtatgacaataagatccatgtgctaaaaaacgcg
ctcgggttacataccgctgtttctcgtgtgcagggcggcaagctgaaagcaaaggtggag
atccgcgtcgctaccgtgtttcgcaacgcgccggaaccgtttttgcgcatgatcgtggtg
cacgagctggcgcacctgaaggagaaagagcataacaaagcgttttaccagttgtgttgt
catatggaaccccagtaccaccagcttgagttcgacacccgactgtggctaacgcagttg
tcgcttgggcagaacaaaatctga

DBGET integrated database retrieval system