KEGG   Escherichia coli K-12 MG1655: b3093
Entry
b3093             CDS       T00007                                 

Symbol
exuT
Name
(RefSeq) hexuronate transporter
  KO
K08191  MFS transporter, ACS family, hexuronate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3093 (exuT)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    b3093 (exuT)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 947601
NCBI-ProteinID: NP_417564
RegulonDB: ECK120002376
ECOCYC: EG12738
ASAP: ABE-0010171
UniProt: P0AA78
Position
3245224..3246522
AA seq 432 aa
MRKIKGLRWYMIALVTLGTVLGYLTRNTVAAAAPTLMEELNISTQQYSYIIAAYSAAYTV
MQPVAGYVLDVLGTKIGYAMFAVLWAVFCGATALAGSWGGLAVARGAVGAAEAAMIPAGL
KASSEWFPAKERSIAVGYFNVGSSIGAMIAPPLVVWAIVMHSWQMAFIISGALSFIWAMA
WLIFYKHPRDQKHLTDEERDYIINGQEAQHQVSTAKKMSVGQILRNRQFWGIALPRFLAE
PAWGTFNAWIPLFMFKVYGFNLKEIAMFAWMPMLFADLGCILGGYLPPLFQRWFGVNLIV
SRKMVVTLGAVLMIGPGMIGLFTNPYVAIMLLCIGGFAHQALSGALITLSSDVFGRNEVA
TANGLTGMSAWLASTLFALVVGALADTIGFSPLFAVLAVFDLLGALVIWTVLQNKPAIEV
AQETHNDPAPQH
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgcgtaaaattaaagggttacgttggtatatgatcgcactggtgacgctcggcaccgtg
cttggttacctgacgcgtaacactgtggcggcagctgcgccaactctgatggaagagtta
aacatctccacccaacagtattcctatatcatcgcagcctattctgctgcttatacggtc
atgcaaccggtagcaggttatgtactggatgtgctgggtacgaaaatcggttatgcaatg
tttgctgtgctgtgggccgtgttctgtggtgcaaccgcgctggcaggtagctggggtggc
ctggctgttgctcgtggtgcggtcggtgccgcggaagcagcgatgatcccggcgggtctg
aaagccagctccgaatggttcccggcgaaagagcgttccatcgcagtaggctactttaac
gtaggttcttcgattggtgcgatgattgcgccgccgctggtggtatgggcaatcgtaatg
cacagctggcagatggcatttatcatctccggtgcattgagctttatctgggcgatggca
tggctgattttctataaacatccgcgcgaccagaagcatctgaccgatgaagaacgcgac
tatattattaatggtcaggaagcccagcaccaggtgagcacggcgaagaaaatgtccgtt
ggtcagatcctgcgtaaccgtcagttctggggtatcgcgctgccgcgtttcctggcagaa
ccggcctggggtacttttaacgcgtggatcccgctgttcatgtttaaagtttacggcttt
aacctgaaagagatcgcgatgttcgcctggatgccgatgctgtttgctgacctcggttgt
atcctcggtggttacctgccgccgctgttccagcgttggtttggtgtgaacctgatcgtt
tcccgtaagatggtcgtaacgctgggtgcagtgctgatgattggcccgggtatgatcggc
ctgttcaccaacccgtatgtcgcaattatgctgctgtgtatcggtggttttgcccaccag
gcactgtctggcgcgctgattacgctctcttccgatgtgtttggtcgtaacgaagtggca
acggcaaacggtttaaccgggatgtccgcatggctggcaagtacgctgtttgcgctggtt
gtcggtgcactggctgacaccatcggcttcagcccgctgttcgcagttctggcagtgttc
gacctgttaggtgcgctggttatctggaccgtgttgcagaacaaaccggcgattgaggtg
gcgcaggaaacacataacgatcccgcaccgcaacattaa

DBGET integrated database retrieval system