KEGG   Escherichia coli K-12 MG1655: b3095Help
Entry
b3095             CDS       T00007                                 

Gene name
yqjA
Definition
(RefSeq) general envelope maintenance protein; DedA family inner membrane protein; putative multidrug efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-GeneID: 947643
NCBI-ProteinID: NP_417566
Pasteur: yqjA
RegulonDB: ECK120004162
ECOCYC: G7609
ASAP: ABE-0010181
UniProt: P0AA63
Position
3247773..3248435
Genome map
AA seq 220 aa AA seqDB search
MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPAAFLPGDSLLVLVGVL
IAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHK
HGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGYMLGKTPV
FLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttgacccaattgctgcaagccctgtgggcgcaggattttgaaaccctggcc
aatccatcgatgattggcatgttgtattttgtcttgtttgtaattttgttccttgaaaac
ggcttgcttccggcggcctttttaccgggcgacagtttactggtattggtcggcgtgttg
attgcgaaaggcgcgatgggctatccgcaaacgattctgctgctgaccgttgccgccagc
ctcggctgctgggtcagctatattcaggggcgatggctgggcaatacccgcaccgtacaa
aactggctatctcatttacccgcgcattatcatcaacgcgcacaccatctttttcataaa
cacggtttatcggcgctgttaattggtcgctttattgcgtttgtcagaacactgctgccg
acgattgccgggttatcagggctgaataacgcgcgctttcagtttttcaactggatgagc
ggtctgctgtgggtattgatcctgacaactctgggttacatgctcggcaaaacgccggta
tttttaaagtacgaggaccagctgatgtcatgcctgatgctgctcccggtggtgctgctg
gtgtttggcctggcaggttctctggtcgtgttatggaaaaagaaatatggaaatcggggg
taa

DBGET integrated database retrieval system