KEGG   Escherichia coli K-12 MG1655: b3114Help
Entry
b3114             CDS       T00007                                 

Gene name
tdcE
Definition
(RefSeq) 2-ketobutyrate formate-lyase/pyruvate formate-lyase 4
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00620  Pyruvate metabolism
eco00640  Propanoate metabolism
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    b3114 (tdcE)
   00640 Propanoate metabolism
    b3114 (tdcE)
   00650 Butanoate metabolism
    b3114 (tdcE)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     b3114 (tdcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical NRDD
Motif
Other DBs
NCBI-GeneID: 947623
NCBI-ProteinID: YP_026205
RegulonDB: ECK120004178
ECOCYC: G7627
ASAP: ABE-0010242
UniProt: P42632
Position
complement(3260124..3262418)
Genome map
AA seq 764 aa AA seqDB search
MKVDIDTSDKLYADAWLGFKGTDWKNEINVRDFIQHNYTPYEGDESFLAEATPATTELWE
KVMEGIRIENATHAPVDFDTNIATTITAHDAGYINQPLEKIVGLQTDAPLKRALHPFGGI
NMIKSSFHAYGREMDSEFEYLFTDLRKTHNQGVFDVYSPDMLRCRKSGVLTGLPDGYGRG
RIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATIRLREELAEHRHALLQIQE
MAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSLGRTASFLDIYIERDFKAGV
LNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWATEVIGGMGLDGRTLVTKNSFR
YLHTLHTMGPAPEPNLTILWSEELPIAFKKYAAQVSIVTSSLQYENDDLMRTDFNSDDYA
IACCVSPMVIGKQMQFFGARANLAKTLLYAINGGVDEKLKIQVGPKTAPLMDDVLDYDKV
MDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSVATDS
LSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDERVDSIACDLVERFMKKIKALPTYR
NAVPTQSILTITSNVVYGQKTGNTPDGRRAGTPFAPGANPMHGRDRKGAVASLTSVAKLP
FTYAKDGISYTFSIVPAALGKEDPVRKTNLVGLLDGYFHHEADVEGGQHLNVNVMNREML
LDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQDVISRTFTQAL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagatattgataccagcgataagctgtacgccgacgcatggcttggctttaaa
ggtacggactggaaaaacgaaattaatgtccgcgattttattcaacataactatacaccg
tatgaaggcgatgaatctttcctcgccgaagcgacgcctgccaccacggaattgtgggaa
aaagtaatggaaggcatccgtatcgaaaatgcaacccacgcgccggttgatttcgatacc
aatattgccaccacaattaccgctcatgatgcgggatatattaaccagccgctggaaaaa
attgttggcctgcaaacggatgcgccgttgaaacgtgcgctacacccgttcggtggcatt
aatatgattaaaagttcattccacgcctatggccgagaaatggacagtgaatttgaatat
ctgtttaccgatctgcgtaaaacccataaccagggcgtatttgatgtttactcaccggat
atgctgcgctgccgtaaatctggcgtgctgaccggtttaccagatggctatggccgtggg
cgcattatcggtgactatcgccgcgtagcgctgtatggcatcagttatctggtacgtgaa
cgcgaactgcaatttgccgatctccagtctcgtctggaaaaaggcgaggatctggaagcc
accatccgtctgcgtgaggagctggcagagcatcgtcatgcgctgttgcagattcaggaa
atggcggcgaaatatggctttgatatctctcgcccggcgcagaatgcgcaggaagcggtg
cagtggctctacttcgcttatctggcggcagtgaaatcgcaaaatggcggcgcgatgtcg
ctgggccgcacggcatcgttcctcgatatctacattgagcgcgactttaaagctggcgta
ctcaatgagcagcaggcacaggaactgatcgatcacttcatcatgaagatccgtatggta
cgcttcctgcgtacaccggaatttgattcgctgttctccggcgacccaatctgggcgacg
gaagtgatcggcgggatggggctggacggtcgtacgctggtgaccaaaaactccttccgc
tatttgcacaccctgcacactatggggccggcaccggaacctaacctgaccattctttgg
tcggaagaattaccgattgccttcaaaaaatatgccgcgcaggtgtcgatcgtcacctct
tccttgcagtatgaaaatgacgatctgatgcgtactgacttcaacagcgacgattacgcg
attgcctgctgcgtcagcccaatggtgattggtaagcaaatgcagttctttggtgcacgc
gctaacctggcgaaaacgctgctctacgcaattaacggcggggtggacgagaagctgaag
attcaggtcgggccgaaaacagcaccgctgatggacgacgtgctggattacgacaaagtg
atggacagcctcgatcacttcatggactggctggcggtgcagtacatcagcgcgctgaat
atcattcactacatgcacgacaagtacagctacgaagcttcgctgatggcgctgcacgat
cgtgatgtctatcgcactatggcatgcggcatcgcgggcctgtcggtggcgacggactcc
ctgtctgccatcaaatatgcccgcgtgaaaccaatccgtgacgaaaacggcctggcggtg
gactttgaaatcgacggtgaatatccgcagtacggcaacaacgacgagcgcgtagacagc
attgcctgcgacctggttgaacgctttatgaagaaaattaaagcgctgccaacctatcgc
aacgccgtccctacccagtcgattctgactatcacttctaacgtggtgtacggccagaaa
accggtaatacgccggacggtcgtcgcgccggaacaccgttcgcgccgggcgctaacccg
atgcatggtcgtgaccgcaaaggtgccgtggcctcattgacgtcggtggcgaaactgccg
ttcacctacgccaaagatgggatctcgtacaccttctcaatcgttcctgcggcgctgggc
aaagaagatccagtacgtaaaaccaaccttgtcggcctgctggatgggtatttccaccac
gaagcggatgtcgaaggcggtcaacacctcaacgtcaacgtaatgaatcgggaaatgctg
ctggatgccatcgagcacccggaaaaatatcctaacctgacaatccgtgtctctggctac
gccgtgcgcttcaacgcactgacccgtgaacagcaacaggatgttatttcacgtaccttt
acccaggcgctctga

DBGET integrated database retrieval system