KEGG   Escherichia coli K-12 MG1655: b3117Help
Entry
b3117             CDS       T00007                                 

Gene name
tdcB
Definition
(RefSeq) L-threonine dehydratase, catabolic
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00260  Glycine, serine and threonine metabolism
eco00290  Valine, leucine and isoleucine biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b3117 (tdcB)
   00290 Valine, leucine and isoleucine biosynthesis
    b3117 (tdcB)
Enzymes [BR:eco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     b3117 (tdcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1948 HTH_9
Motif
Other DBs
NCBI-GeneID: 947633
NCBI-ProteinID: NP_417587
Pasteur: tdcB
RegulonDB: ECK120000979
ECOCYC: EG10990
ASAP: ABE-0010249
UniProt: P0AGF6
Position
complement(3265039..3266028)
Genome map
AA seq 329 aa AA seqDB search
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatattacatacgatctgccggttgctattgatgacattattgaagcgaaacaacga
ctggctgggcgaatttataaaacaggcatgcctcgctccaactattttagtgaacgttgc
aaaggtgaaatattcctgaagtttgaaaatatgcagcgtacgggttcatttaaaattcgt
ggcgcatttaataaattaagttcactgaccgatgcggaaaaacgcaaaggcgtggtggcc
tgttctgcgggcaaccatgcgcaaggggtttccctctcctgcgcgatgctgggtatcgac
ggtaaagtggtgatgccaaaaggtgcgccaaaatccaaagtagcggcaacgtgcgactac
tccgcagaagtcgttctgcatggtgataacttcaacgacactatcgctaaagtgagcgaa
attgtcgaaatggaaggccgtatttttatcccaccttacgatgatccgaaagtgattgct
ggccagggaacgattggtctggaaattatggaagatctctatgatgtcgataacgtgatt
gtgccaattggtggtggcggtttaattgctggtattgcggtggcaattaaatctattaac
ccgaccattcgtgttattggcgtacagtctgaaaacgttcacggcatggcggcttctttc
cactccggagaaataaccacgcaccgaactaccggcaccctggcggatggttgtgatgtc
tcccgcccgggtaatttaacttacgaaatcgttcgtgaattagtcgatgacatcgtgctg
gtcagcgaagacgaaatcagaaacagtatgattgccttaattcagcgcaataaagtcgtc
accgaaggcgcaggcgctctggcatgtgctgcattattaagcggtaaattagaccaatat
attcaaaacagaaaaaccgtcagtattatttccggcggcaatatcgatctttctcgcgtc
tctcaaatcaccggtttcgttgacgcttaa

DBGET integrated database retrieval system