KEGG   Escherichia coli K-12 MG1655: b3139Help
Entry
b3139             CDS       T00007                                 

Gene name
agaC
Definition
(RefSeq) galactosamine-specific PTS enzyme IIC component
  KO
K10985  PTS system, galactosamine-specific IIC component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00052  Galactose metabolism
eco02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    b3139 (agaC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    b3139 (agaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3139 (agaC)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactosamine-specific II component [MD:M00287]
    b3139 (agaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-GeneID: 947652
NCBI-ProteinID: NP_417608
Pasteur: agaC
RegulonDB: ECK120002383
ECOCYC: EG12770
ASAP: ABE-0010312
UniProt: P42910 A0A387CTM4
Position
3284685..3285488
Genome map
AA seq 267 aa AA seqDB search
MHEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELA
FAGLTPAGGVQPPNPIMAGLMTTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSL
FMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTYLAQGAMQALVKAMPAWLTH
GFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF
FNAKSRQQAQPQPVASKNEEEDYSNGI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaataaccctacttcagggattatccctggcggcgttagtttttgttctgggg
attgatttttggctggaagccttatttttattccgcccgataatcgtttgtaccctaact
ggcgctattctcggtgatattcagactggcttaattaccggtggtctgacagagttggct
ttcgccggattaacccctgcaggtggtgttcagccgcccaacccgattatggcgggtctg
atgaccaccgtcattgcatggtctacgggcgttgatgccaaaacagcaattggtcttggc
ctgccgtttagtttgttaatgcagtacgtcattctgttcttctattccgctttctcatta
tttatgaccaaagccgataaatgcgcgaaagaggcggatacggcagcgttttcccggctt
aactggacaacgatgctcatcgtcgcttcagcgtatgcggtgattgctttcctctgtact
tacctggcacagggggcgatgcaggcgctggtgaaagcgatgcccgcctggctgacccac
ggctttgaagtggctggcggtattctgcctgccgttggttttggcttgctgctgcgcgta
atgttcaaagcgcaatatatcccttacctgatcgccggtttcctgtttgtttgctacatc
caggtcagcaacctgttgccggttgccgtactgggcgcaggctttgcggtgtatgagttt
ttcaatgcgaaatcccggcagcaagcgcaaccgcagcccgttgccagtaaaaatgaagaa
gaggactacagcaatgggatctga

DBGET integrated database retrieval system