KEGG   Escherichia coli K-12 MG1655: b3177
Entry
b3177             CDS       T00007                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00790  Folate biosynthesis
eco01100  Metabolic pathways
eco01240  Biosynthesis of cofactors
Module
eco_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    b3177 (folP)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     b3177 (folP)
SSDB
Motif
Pfam: Pterin_bind DUF6305 Trp_ring
Other DBs
NCBI-GeneID: 947691
NCBI-ProteinID: NP_417644
Pasteur: folP
RegulonDB: ECK120002570
ECOCYC: EG50011
ASAP: ABE-0010441
UniProt: P0AC13
Structure
PDB: 

Position
complement(3324063..3324911)
AA seq 282 aa
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaaactctttgcccagggtacttcactggaccttagccatcctcacgtaatggggatc
ctcaacgtcacgcctgattccttttcggatggtggcacgcataactcgctgatagatgcg
gtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggtggcgag
tccacgcgcccaggggcggcggaagttagcgttgaagaagagttgcaacgtgttattcct
gtggttgaggcaattgctcaacgcttcgaagtctggatctcagtcgatacatccaaacca
gaagtcatccgtgagtcagcgaaagttggcgctcacattattaatgatatccgctccctt
tccgaacctggcgctctggaggcggctgcagaaaccggtttaccggtttgtctgatgcat
atgcagggaaatccaaaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaa
gtgaatcgctactttattgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagag
aaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactattcatta
ctggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatgtcacga
aaatcgatgattgggcagctgctgaacgtggggccgtccgagcgcctgagcggtagtctg
gcctgtgcggtcattgccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaa
gaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system