KEGG   Escherichia coli K-12 MG1655: b3190
Entry
b3190             CDS       T00007                                 

Gene name
ibaG
Definition
(RefSeq) acid stress protein IbaG
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: BolA DUF3206 Annexin_like
Other DBs
NCBI-GeneID: 947958
NCBI-ProteinID: NP_417657
Pasteur: yrbA
RegulonDB: ECK120004207
ECOCYC: G7657
ASAP: ABE-0010481
UniProt: P0A9W6
Structure
PDB: 
1NY8

Position
complement(3336549..3336803)
AA seq 84 aa
MENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADN
RIHAVSIKAYTPAEWARDRKLNGF
NT seq 255 nt   +upstreamnt  +downstreamnt
atggaaaataatgaaattcagagcgtgttgatgaacgctctctccctccaggaagtccac
gtttccggcgatggcagccactttcaggttattgccgtgggtgagttgtttgacggcatg
agtcgggttaaaaaacagcagacggtctatggtccgctgatggaatatattgcggataac
cgcattcatgctgtgtcgatcaaagcgtatacccctgcggagtgggcgcgcgatcgcaaa
ctgaacggcttttga

DBGET integrated database retrieval system