KEGG   Escherichia coli K-12 MG1655: b3224
Entry
b3224             CDS       T00007                                 

Symbol
nanT
Name
(RefSeq) N-acetylneuraminate:H(+) symporter
  KO
K03290  MFS transporter, SHS family, sialic acid transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3224 (nanT)
Transporters [BR:eco02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Sialate:H+ symporter (SHS) family [TC:2.A.1.12]
    b3224 (nanT)
SSDB
Motif
Pfam: MFS_1 Sugar_tr UPF0029
Other DBs
NCBI-GeneID: 947740
NCBI-ProteinID: NP_417691
Pasteur: nanT
RegulonDB: ECK120002695
ECOCYC: G436
ASAP: ABE-0010577
UniProt: P41036
Position
complement(3371084..3372574)
AA seq 496 aa
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSAGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgagtactacaacccagaatatcccgtggtatcgccatctcaaccgtgcacaatggcgc
gcattttccgctgcctggttgggatatctgcttgacggttttgatttcgttttaatcgcc
ctggtactcaccgaagtacaaggtgaattcgggctgacgacggtgcaggcggcaagtctg
atctctgcagcctttatctctcgctggttcggcggcctgatgctcggcgctatgggtgac
cgctacgggcgtcgtctggcaatggtcaccagcatcgttctcttctcggccgggacgctg
gcctgcggctttgcgccaggctacatcaccatgtttatcgctcgtctggtcatcggcatg
gggatggcgggtgaatacggttccagcgccacctatgtcattgaaagctggccaaaacat
ctgcgtaacaaagccagtggttttttgatttcaggcttctctgtgggggccgtcgttgcc
gctcaggtctatagcctggtggttccggtctggggctggcgtgcgctgttctttatcggc
attttgccaatcatctttgctctctggctgcgtaaaaacatcccggaagcggaagactgg
aaagagaaacacgcaggtaaagcaccagtacgcacaatggtggatattctctaccgtggt
gaacatcgcattgccaatatcgtaatgacactggcggcggctactgcgctgtggttctgc
ttcgccggtaacctgcaaaatgccgcgatcgtcgctgttcttgggctgttatgcgccgca
atctttatcagctttatggtgcagagtgcaggcaaacgctggccaacgggcgtaatgctg
atggtggtcgtgttgtttgctttcctctactcatggccgattcaggcgctgctgccaacg
tatctgaaaaccgatctggcttataacccgcatactgtagccaatgtgctgttctttagt
ggctttggcgcggcggtgggatgctgcgtaggtggcttcctcggtgactggctgggaacc
cgcaaagcgtacgtttgtagcctgctggcctcgcagctgctgattattccggtatttgcg
attggcggcgcaaacgtctgggtgctcggtctgttactgttcttccagcaaatgcttgga
caagggatcgccgggatcttaccaaaactgattggcggttatttcgataccgaccagcgt
gcagcgggcctgggctttacctacaacgttggcgcattgggcggtgcactggccccaatc
atcggcgcgttgatcgctcaacgtctggatctgggtactgcgctggcatcgctctcgttc
agtctgacgttcgtggtgatcctgctgattgggctggatatgccttctcgcgttcagcgt
tggttgcgcccggaagcgttgcgtactcatgacgctatcgacggtaaaccattcagcggt
gccgtgccgtttggcagcgccaaaaacgatttagtcaaaaccaaaagttaa

DBGET integrated database retrieval system