KEGG   Escherichia coli K-12 MG1655: b3230Help
Entry
b3230             CDS       T00007                                 

Gene name
rpsI
Definition
(RefSeq) 30S ribosomal subunit protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3230 (rpsI)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3230 (rpsI)
  Bacteria
    b3230 (rpsI)
  Archaea
    b3230 (rpsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9 Flg_hook
Motif
Other DBs
NCBI-GeneID: 949000
NCBI-ProteinID: NP_417697
Pasteur: rpsI
RegulonDB: ECK120000899
ECOCYC: EG10908
ASAP: ABE-0010597
UniProt: P0A7X3
Structure
PDB: 

Position
complement(3377815..3378207)
Genome map
AA seq 130 aa AA seqDB search
MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEK
LDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRK
ARRRPQFSKR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatcaatactacggcactggtcgccgcaaaagttccgcagctcgcgttttc
atcaaaccgggcaacggtaaaatcgtaatcaaccaacgttctctggaacagtacttcggt
cgtgaaactgcccgcatggtagttcgtcagccgctggaactggtcgacatggttgagaaa
ctggacctgtacatcaccgttaaaggtggtggtatctctggtcaggctggtgcgatccgt
cacggtatcacccgcgctctgatggaatacgacgagtccctgcgttctgaactgcgtaaa
gctggcttcgttactcgtgacgctcgtcaggttgaacgtaagaaagtcggtctgcgtaaa
gcacgtcgtcgtccgcagttctccaaacgttaa

DBGET integrated database retrieval system