KEGG   Escherichia coli K-12 MG1655: b3258Help
Entry
b3258             CDS       T00007                                 

Gene name
panF
Definition
(RefSeq) pantothenate:Na(+) symporter
  KO
K14392  sodium/pantothenate symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3258 (panF)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3258 (panF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 947752
NCBI-ProteinID: NP_417724
Pasteur: panF
RegulonDB: ECK120000678
ECOCYC: EG10685
ASAP: ABE-0010695
UniProt: P16256 A0A387CWL0
Position
3407607..3409058
Genome map
AA seq 483 aa AA seqDB search
MQLEVILPLVAYLVVVFGISVYAMRKRSTGTFLNEYFLGSRSMGGIVLAMTLTATYISAS
SFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAILARRYNAVTLNDMLFARYQS
RLLVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLLIFGISIALYTAFGGFRA
SVLNDTMQGLVMLIGTVVLLIGVVHAAGGLSNAVQTLQTIDPQLVTPQGADDILSPAFMT
SFWVLVCFGVIGLPHTAVRCISYKDSKAVHRGIIIGTIVVAILMFGMHLAGALGRAVIPD
LTVPDLVIPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIRPDQM
QNETRLKRMSAVITLVLGALLLLAAWKPPEMIIWLNLLAFGGLEAVFLWPLVLGLYWERA
NAKGALSAMIVGGVLYAVLATLNIQYLGFHPIVPSLLLSLLAFLVGNRFGTSVPQATVLT
TDK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgaagtaattctaccgctggtcgcctatctggtggtggtgttcggtatctcg
gtttatgcgatgcgtaaacggagcaccggcaccttccttaatgagtatttcctcggcagc
cgctctatgggcggtattgtgctggcgatgacgctcaccgcgacctatatcagtgccagt
tcgtttatcggcgggccaggagctgcttataaatacgggctgggctgggtattgctggcg
atgattcagcttcctgcagtctggctttcactcggtattctcggcaagaagtttgcgatt
cttgcgcgccgctacaatgcagtgacgctgaacgatatgctgtttgcccgctaccagagt
cgtcttctggtgtggctggcgagtttgagtttgctggttgcgttcgttggtgcgatgacc
gtgcagtttatcggcggtgcgcgcctgctggaaaccgcggcgggtattccttatgaaacc
gggctgctgatttttggtatcagcattgcgttatataccgcctttggtggctttcgcgcc
agcgtgctgaacgacaccatgcaagggcttgtgatgctgattggcaccgttgtgctgctt
attggcgtagtacatgccgctggcggcttaagtaacgcagtacagaccttgcaaaccatc
gatccgcaactggttacgccacaaggcgctgacgatattctgtcgcctgcctttatgacg
tcgttctgggtactggtgtgttttggcgtgattggcctgccgcatactgcggtgcgctgt
atctcttataaagacagcaaagccgtacatcgggggatcatcatcggtacgattgtggtc
gcaattctgatgttcggtatgcacctggccggagcgttaggtcgggcggtgatccccgat
ctcaccgtaccggacctggtgatcccaacgttaatggtaaaagtgctgccaccgtttgct
gccgggatcttcctggctgcaccgatggctgcgatcatgtcgacaattaacgcccaactg
ctgcaaagttccgctacgatcattaaagatctctatctgaatatccgtccggatcaaatg
caaaacgagacgcgtctgaagcggatgtcggcggtaattacgttagttctcggcgcgttg
ctgctgcttgccgcctggaagccgccagaaatgatcatctggctgaatttgttggccttc
ggtgggctggaagccgttttcctgtggccgctggtgctgggtctttactgggaacgcgcc
aacgccaaaggcgcgctaagtgcgatgatcgttggcggcgtgctgtatgccgtactcgcg
acgctgaatattcagtacctgggcttccaccctatcgtgccctcgttactactaagtttg
ctggctttcctggtcggaaaccgtttcggtacatccgtcccgcaagctaccgttttgact
actgataaataa

DBGET integrated database retrieval system