KEGG   Escherichia coli K-12 MG1655: b3290Help
Entry
b3290             CDS       T00007                                 

Gene name
trkA
Definition
(RefSeq) NAD-binding component of Trk potassium transporters
  KO
K03499  trk system potassium uptake protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3290 (trkA)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3290 (trkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C F420_oxidored NAD_binding_7 Shikimate_DH Sacchrp_dh_NADP ApbA NAD_binding_2 3HCDH_N NAD_binding_10 NAD_Gly3P_dh_N AlaDh_PNT_C GFO_IDH_MocA Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N adh_short Epimerase XdhC_C DAO
Motif
Other DBs
NCBI-GeneID: 947788
NCBI-ProteinID: NP_417748
Pasteur: trkA
RegulonDB: ECK120001008
ECOCYC: EG11019
ASAP: ABE-0010787
UniProt: P0AGI8 A0A387CMA2
Position
3436518..3437894
Genome map
AA seq 458 aa AA seqDB search
MKIIILGAGQVGGTLAENLVGENNDITVVDTNGERLRTLQDKFDLRVVQGHGSHPRVLRE
AGADDADMLVAVTSSDETNMVACQVAYSLFNTPNRIARIRSPDYVRDADKLFHSDAVPID
HLIAPEQLVIDNIYRLIEYPGALQVVNFAEGKVSLAVVKAYYGGPLIGNALSTMREHMPH
IDTRVAAIFRHDRPIRPQGSTIVEAGDEVFFIAASQHIRAVMSELQRLEKPYKRIMLVGG
GNIGAGLARRLEKDYSVKLIERNQQRAAELAEKLQNTIVFFGDASDQELLAEEHIDQVDL
FIAVTNDDEANIMSAMLAKRMGAKKVMVLIQRRAYVDLVQGSVIDIAISPQQATISALLS
HVRKADIVGVSSLRRGVAEAIEAVAHGDESTSRVVGRVIDEIKLPPGTIIGAVVRGNDVM
IANDNLRIEQGDHVIMFLTDKKFITDVERLFQPSPFFL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcattctgggtgccggccaggttggcggcacactggcggaaaacctggtt
ggcgagaacaacgatattactgttgtcgataccaacggtgagcgtctgcggaccttacag
gataaatttgacctgcgggtcgtgcaggggcatggctctcatccacgcgtattgcgggag
gcaggtgccgacgacgccgatatgctggttgctgtaaccagttcagatgaaaccaatatg
gttgcctgccaggtagcctactcacttttcaacacccctaatcgcatcgctcgtatccgc
tcaccagactacgtgcgcgatgccgataagctatttcattcagatgctgtgccgattgat
catctgatcgcaccagagcagttggttatcgataatatttaccgactgattgagtatccc
ggcgcattgcaggtggtgaacttcgctgagggtaaagtcagcctggctgtggttaaagcc
tattatggcggcccgctgattggtaatgcactttcgaccatgcgcgaacatatgccacat
atcgatactcgtgtggcagcaattttccgccacgatcgccccattcgtccgcaaggttcg
accattgttgaagctggtgatgaagtgttctttattgccgcttcacagcatatccgcgcg
gtgatgagtgaattacagcgactggaaaaaccgtataagcggatcatgctggttggtggc
ggtaatatcggtgcagggctggcgcgtcgtctggaaaaagattacagcgttaaactcatc
gaacgtaatcagcagcgcgctgccgaactggcggaaaagttacagaatacgatcgtcttt
tttggtgatgcgtcggatcaagaactactggccgaagaacatatcgatcaagttgatctg
tttattgccgtcaccaacgatgacgaggccaatatcatgtccgccatgcttgccaaacgt
atgggtgcgaaaaaggtgatggtattgatccagcgtcgcgcttatgtggatctggttcag
gggagcgttatcgatattgcgatttcaccacaacaagcaactatttctgcgttgcttagc
catgtgcgaaaagcagatattgttggtgtttcctcattgcgccgcggcgtagcagaagct
attgaagccgttgctcacggtgatgaaagcacctcacgcgttgtcggcagagtcattgac
gaaatcaagctaccgccaggaacgattattggagcggtggtacgtggaaacgacgtgatg
attgccaatgacaatctgcgcattgagcaaggcgatcacgtaattatgttcctcacagat
aaaaagtttattaccgacgtcgaaagactcttccagccaagccctttcttcttgtaa

DBGET integrated database retrieval system