KEGG   Escherichia coli K-12 MG1655: b3291
Entry
b3291             CDS       T00007                                 

Symbol
mscL
Name
(RefSeq) large conductance mechanosensitive channel
  KO
K03282  large conductance mechanosensitive channel
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3291 (mscL)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b3291 (mscL)
SSDB
Motif
Pfam: MscL OAD_gamma UPF0239 Ac110_PIF
Other DBs
NCBI-GeneID: 947787
NCBI-ProteinID: NP_417749
Pasteur: mscL
RegulonDB: ECK120001162
ECOCYC: EG11180
ASAP: ABE-0010790
UniProt: P0A742
Structure
PDB: 
4LKU

Position
3438024..3438434
AA seq 136 aa
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT
LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV
LLTEIRDLLKEQNNRS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgagcattattaaagaatttcgcgaatttgcgatgcgcgggaacgtggtggatttggcg
gtgggtgtcattatcggtgcggcattcgggaagattgtctcttcactggttgccgatatc
atcatgcctcctctgggcttattaattggcgggatcgattttaaacagtttgctgtcacg
ctacgcgatgcgcagggggatatccctgctgttgtgatgcattacggtgtcttcattcaa
aacgtctttgattttctgattgtggcctttgccatctttatggcgattaagctaatcaac
aaactgaatcggaaaaaagaagaaccagcagccgcacctgcaccaactaaagaagaagta
ttactgacagaaattcgtgatttgctgaaagagcagaataaccgctcttaa

DBGET integrated database retrieval system