KEGG   Escherichia coli K-12 MG1655: b3337Help
Entry
b3337             CDS       T00007                                 

Gene name
bfd
Definition
(RefSeq) bacterioferritin-associated ferredoxin
  KO
K02192  bacterioferritin-associated ferredoxin
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    b3337 (bfd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_BFD
Motif
Other DBs
NCBI-GeneID: 947836
NCBI-ProteinID: NP_417796
Pasteur: bfd
RegulonDB: ECK120001163
ECOCYC: EG11181
ASAP: ABE-0010906
UniProt: P0AE56
Position
complement(3466797..3466991)
Genome map
AA seq 64 aa AA seqDB search
MYVCLCNGISDKKIRQAVRQFSPHSFQQLKKFIPVGNQCGKCVRAAREVMEDELMQLPEF
KESA
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtttgtctttgtaatggtatcagcgataaaaaaattcgtcaggctgtgcgccag
ttttcccctcactcgttccagcaattaaaaaaatttattccggtcggcaatcagtgcggt
aaatgtgtccgggccgcgcgtgaagtgatggaggatgaattaatgcagctgccggagttt
aaggagtccgcataa

DBGET integrated database retrieval system