KEGG   Escherichia coli K-12 MG1655: b3340
Entry
b3340             CDS       T00007                                 

Gene name
fusA
Definition
(RefSeq) elongation factor G
  KO
K02355  elongation factor G
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eco03012]
    b3340 (fusA)
   03029 Mitochondrial biogenesis [BR:eco03029]
    b3340 (fusA)
Translation factors [BR:eco03012]
 Eukaryotic type
  Elongation factors
   b3340 (fusA)
 Prokaryotic type
   b3340 (fusA)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    b3340 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    b3340 (fusA)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_III EFG_C GTP_EFTU_D2 RF3_C Slu7
Other DBs
NCBI-GeneID: 947847
NCBI-ProteinID: NP_417799
Pasteur: fusA
RegulonDB: ECK120000353
ECOCYC: EG10360
ASAP: ABE-0010914
UniProt: P0A6M8
Structure
PDB: 
2RDO 3J0E

Position
complement(3471400..3473514)
AA seq 704 aa
MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQ
PQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVNQIKTRLGANPVPLQLAIGAEEHFT
GVVDLVKMKAINWNDADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKYLGG
EELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPSPVDVPAINGILD
DGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYSGVVNSGDTVLNSVKAARERF
GRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCDPDAPIILERMEFPEPVISIAV
EPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIVDRMKREFNVE
ANVGKPQVAYRETIRQKVTDVEGKHAKQSGGRGQYGHVVIDMYPLEPGSNPKGYEFINDI
KGGVIPGEYIPAVDKGIQEQLKAGPLAGYPVVDMGIRLHFGSYHDVDSSELAFKLAASIA
FKEGFKKAKPVLLEPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPL
SEMFGYATQLRSLTKGRASYTMEFLKYDEAPSNVAQAVIEARGK
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggctcgtacaacacccatcgcacgctaccgtaacatcggtatcagtgcgcacatcgac
gccggtaaaaccactactaccgaacgtattctgttctacaccggtgtaaaccataaaatc
ggtgaagttcatgacggcgctgcaaccatggactggatggagcaggagcaggaacgtggt
attaccatcacttccgctgcgactactgcattctggtctggtatggctaagcagtatgag
ccgcatcgcatcaacatcatcgacaccccggggcacgttgacttcacaatcgaagtagaa
cgttccatgcgtgttctcgatggtgcggtaatggtttactgcgcagttggtggtgttcag
ccgcagtctgaaaccgtatggcgtcaggcaaacaaatataaagttccgcgcattgcgttc
gttaacaaaatggaccgcatgggtgcgaacttcctgaaagttgttaaccagatcaaaacc
cgtctgggcgcgaacccggttccgctgcagctggcgattggtgctgaagaacatttcacc
ggtgttgttgacctggtgaaaatgaaagctatcaactggaacgacgctgaccagggcgta
accttcgaatacgaagatatcccggcagacatggttgaactggctaacgaatggcaccag
aacctgatcgaatccgcagctgaagcttctgaagagctgatggaaaaatacctgggtggt
gaagaactgactgaagcagaaatcaaaggtgctctgcgtcagcgcgttctgaacaacgaa
atcatcctggtaacctgtggttctgcgttcaagaacaaaggtgttcaggcgatgctggat
gcggtaattgattacctgccatccccggttgacgtacctgcgatcaacggtatcctggac
gacggtaaagacactccggctgaacgtcacgcaagtgatgacgagccgttctctgcactg
gcgttcaaaatcgctaccgacccgtttgttggtaacctgaccttcttccgtgtttactcc
ggtgtggttaactctggtgataccgtactgaactccgtgaaagctgcacgtgagcgtttc
ggtcgtatcgttcagatgcacgctaacaaacgtgaagagatcaaagaagttcgcgcgggc
gacatcgctgctgctatcggtctgaaagacgtaaccactggtgacaccctgtgtgacccg
gatgcgccgatcattctggaacgtatggaattccctgagccggtaatctccatcgcagtt
gaaccgaaaaccaaagctgaccaggaaaaaatgggtctggctctgggccgtctggctaaa
gaagacccgtctttccgtgtatggactgacgaagaatctaaccagaccatcatcgcgggt
atgggcgaactgcacctcgacatcatcgttgaccgtatgaagcgtgaattcaacgttgaa
gcgaacgtaggtaaaccgcaggttgcttaccgtgaaactatccgccagaaagttaccgat
gttgaaggtaaacacgcgaaacagtctggtggtcgtggtcagtatggtcatgttgttatc
gacatgtacccgctggagccgggttcaaacccgaaaggctacgagttcatcaacgacatt
aaaggtggtgtaatccctggcgaatacatcccggccgttgataaaggtatccaggaacag
ctgaaagcaggtccgctggcaggctacccggtagtagacatgggtattcgtctgcacttc
ggttcttaccatgacgttgactcctctgaactggcgtttaaactggctgcttctatcgcc
tttaaagaaggctttaagaaagcgaaaccagttctgcttgagccgatcatgaaggttgaa
gtagaaactccggaagagaacaccggtgacgttatcggtgacttgagccgtcgtcgtggt
atgctcaaaggtcaggaatctgaagttactggcgttaagatccacgctgaagtaccgctg
tctgaaatgttcggatacgcaactcagctgcgttctctgaccaaaggtcgtgcatcatac
actatggaattcctgaagtatgatgaagcgccgagtaacgttgctcaggccgtaattgaa
gcccgtggtaaataa

DBGET integrated database retrieval system