KEGG   Escherichia coli K-12 MG1655: b3342Help
Entry
b3342             CDS       T00007                                 

Gene name
rpsL
Definition
(RefSeq) 30S ribosomal subunit protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    b3342 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eco03011]
    b3342 (rpsL)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    b3342 (rpsL)
  Bacteria
    b3342 (rpsL)
  Archaea
    b3342 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23 RPS12
Motif
Other DBs
NCBI-GeneID: 947845
NCBI-ProteinID: NP_417801
Pasteur: rpsL
RegulonDB: ECK120000902
ECOCYC: EG10911
ASAP: ABE-0010919
UniProt: P0A7S3
Structure
PDB: 

Position
complement(3474178..3474552)
Genome map
AA seq 124 aa AA seqDB search
MATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
RPKA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagttaaccagctggtacgcaaaccacgtgctcgcaaagttgcgaaaagcaac
gtgcctgcgctggaagcatgcccgcaaaaacgtggcgtatgtactcgtgtatatactacc
actcctaaaaaaccgaactccgcgctgcgtaaagtatgccgtgttcgtctgactaacggt
ttcgaagtgacttcctacatcggtggtgaaggtcacaacctgcaggagcactccgtgatc
ctgatccgtggcggtcgtgttaaagacctcccgggtgttcgttaccacaccgtacgtggt
gcgcttgactgctccggcgttaaagaccgtaagcaggctcgttccaagtatggcgtgaag
cgtcctaaggcttaa

DBGET integrated database retrieval system